KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_10540Help
Entry
KPR0928_10540     CDS       T03371                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AIE28055
LinkDB All DBs
Position
2169459..2170502
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMGTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLAMAGKLGATTVINGAKEDTVARCQQFSGDIGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaaccccgggtacgatgaaaattattgccgccgat
atcccggtacccaaagagcatgaagtgctgatcaaagttgaatacgttggtatttgcggt
tcagatgttcacgggtttgaatcgggcccttttattccgccgaaagacccaaaccaggaa
attggtctcgggcatgaatgtgccggtacggtggtggcggtgggaagtcgcgtcagtaaa
tttaaaccgggcgaccgggtgaacattgaacccggcgtgccgtgcggccactgccgctac
tgtctggaggggaaatacaacatctgccctgatgtcgactttatggccacgcagcctaac
tatcgcggcgcgctaacccactatctatgccatccggaaagcttcacttacaagctaccc
gataacatgggcaccatggaaggcgcgctggtagagcctgcggcggtagggatgcatgcc
gcaatgctggctgacgtgaagcctggcaagaaaatcgtcatcctgggggccggctgtatt
ggcttaatgaccctgcaagcctgtaagtgtttaggggcaaccgacatcgccgttgtcgat
gttctggaaaagcgtctggccatggccgggaagcttggggcgacgaccgtcatcaacggt
gcgaaagaggacaccgtcgcccgctgtcagcaattctccggcgatatcggggcagacatt
gtttttgaaacggccggctcggcgatcaccgtgaagcaggctccgtatctggtgatgcgc
ggcgggaaaatcatgatcgttggtacggttcccggagattcggcgattaattttctcaaa
attaaccgtgaagtctcaattcagaccgttttccgctatgccaaccgctatccggtcacc
attgaagccatttcctccgggcgtttcgatgtcaagtcgatggtgacgcatatttatgat
tatgaagatgttcagcgcgcgtttgacgagtccgttaacaacaaacgcgaaattatcaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system