KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_12690Help
Entry
KPR0928_12690     CDS       T03371                                 

Definition
(GenBank) transporter
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 LacY_symp MFS_2
Motif
Other DBs
NCBI-ProteinID: AIE28468
LinkDB All DBs
Position
complement(2598327..2599523)
Genome map
AA seq 398 aa AA seqDB search
MITTLRRSTIALLASSLLLTIGRGATLPFMTIYLTRRFQLEVDVIGYALSLALVVGVLFS
MGFGILADRFDKKRYMVWSVLVFILGFSAIPLVNNAPLVVIFFALINCAYSVFSTVLKAW
FADRLTAEKKARIFSLNYTILNIGWTVGPPIGTLLVMHSINLPFWLAAACAAFPLVFIQL
FLQRDGAAAAQPGAAPWSPSVLLRDRALLWFTCSGLLASFVGGAFASCLSQYVLVVASSD
FAEKVVAVVLPVNAAVVVALQYAVGRRLSARNIRPLMTFGTVCFVIGLVGFMFSGASLWA
WGISAAIFTLGEVIYAPGEYMLIDHIAPPGMKASYFSAQSLGWLGAAFNPMLTGLILTHL
PHWSLFVILIVAIVAAWLMIFRGINARPWQPDSPLANA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccactctccggcgctccaccatcgcgctgctggcatcgtcgttactgttgact
atcggccgcggggccacactgccgtttatgaccatctatctcacccgacgctttcagctg
gaagtggatgtgattggctatgccctgtcgctggcgctggtggttggggtgttgttcagc
atgggttttggcatcctcgctgacaggttcgataaaaagcgctatatggtgtggtcagtg
ctggtgtttattctcggcttcagcgcaataccgctggtcaataacgcccccctggtggtg
atcttctttgcgctgatcaactgcgcctactcggtcttttccaccgtcctgaaagcctgg
ttcgccgaccggctgacggcagagaaaaaagcgcgcatcttctcgctgaactacaccatc
ctcaacatcggctggaccgttgggccgcccatcggcaccctgctggtaatgcacagtatc
aatttgccgttctggctggcggccgcctgcgccgcctttccgctggtgtttattcagctg
tttcttcagcgggatggcgccgccgcggcccagccgggcgccgctccctggtcgccttcg
gtgttgctgcgcgaccgggcgctgctgtggtttacctgctccgggctgctggcctccttc
gtcggcggcgccttcgcctcctgtctctcgcagtatgtgctggtggtcgccagcagcgat
ttcgccgagaaagtggtggccgtggtgctgccggtcaacgccgcggtggtggttgctctg
cagtacgcggttggccggcggctgagcgcgagaaatatccgcccgctgatgaccttcggc
accgtctgctttgtgatcggccttgtgggctttatgttctctggcgccagcctgtgggcg
tgggggatctcggcggcgatcttcaccctcggggaagtgatttatgcccccggggagtat
atgctgattgaccatattgccccgccggggatgaaggcaagctacttctccgcccagtcg
ctggggtggctgggggcggcattcaacccgatgctgacggggttgatcctcacccatctg
ccgcactggtcgctttttgtcattcttatcgtggcgattgtcgccgcctggctgatgatt
ttccgcgggatcaatgcccgcccctggcaaccggattctccgctggccaacgcctga

DBGET integrated database retrieval system