KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_14665Help
Entry
KPR0928_14665     CDS       T03371                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Brite
Enzymes [BR:kpq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPR0928_14665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIE28848
LinkDB All DBs
Position
2985606..2986187
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPEGELAAAIAKSFGSFADFKAKFTDAAAKNFG
AGWTWLVKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYLDHFWA
LVNWKFVAANLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccatatgcaaaagacgccctggcgccgcacatttcc
gcagaaaccctggaatatcactacggtaaacaccaccaggcgtatgtcactaacctcaac
aacctgatcaaaggcactgcgttcgaaggcaaatccctcgaagagatcgtccgcacttct
gaaggcggcgtattcaacaacgcagcgcaggtctggaaccacaccttctactggaactgc
ctcgcgcctaacgccggcggcgaaccggaaggcgaactggcggccgcaatcgccaaatct
ttcggcagcttcgcggattttaaagccaaatttaccgatgccgcggcgaaaaacttcggc
gctggctggacctggctggtcaaaaatgccgacggcagcctggctatcgtctccaccagc
aacgccggcaccccgctgaccaccgacgcgaagccgctgctgaccgttgacgtttgggaa
cacgcctactacatcgactaccgcaacgcccgtccaagctacctggaccacttctgggcg
ctggtaaactggaagtttgttgcggctaacctcgcggcataa

DBGET integrated database retrieval system