KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_0203Help
Entry
KPR_0203          CDS       T02793                                 

Gene name
ppc
Definition
(GenBank) highly similar to phosphoenolpyruvate carboxylase from Klebsiella pneumoniae strain 342 (sp|B5XZ20)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00620  Pyruvate metabolism
kpr00680  Methane metabolism
kpr01100  Metabolic pathways
kpr01120  Microbial metabolism in diverse environments
kpr01200  Carbon metabolism
Module
kpr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_0203 (ppc)
  Energy metabolism
   00680 Methane metabolism
    KPR_0203 (ppc)
Enzymes [BR:kpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KPR_0203 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCI74436
UniProt: R4Y498
LinkDB All DBs
Position
complement(209251..211902)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISANGEAASNPEVIARTLRKLKDQPNLNEE
TIKQAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRSQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRMKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSISAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGSELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtcaaacgacgaactgctgccggtggcccgtgccttcagccagtttctgaat
ctggccaacaccgctgagcagtaccacagcatttcggccaatggcgaagcggccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaacgaagag
accatcaaacaagcggtggaatcgctgtctctggagctggtgttaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaagtgaacaactgccttaagcag
ttggacaacaaagatatcgctgactacgagcaccatcagctaatgcgccgtctgcgccag
ctgatcgcccagtcgtggcataccgatgaaattcgtaagcaccgcccttccccggtcgat
gaagccaaatggggcttcgcggtggtggaaaacagcctgtgggaaggggtgcctaactat
ctgcgcgagctgaacgaacagctggaagccaaccttggctatcagctgccggtggacttc
gtcccggtgcgtttcacctcgtggatgggcggcgaccgcgacggcaacccgaacgtgact
gccgacatcacccgccacgtgctgctgctcagccgctggaaagcgaccgacctgttcctc
aaagacgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgagctgcgc
gccctggctggcgccgagggcgctcaggaaccttaccgttatctgatgaaaaaactgcgc
tctcagctgatggaaacccaggcctggctggaagcgcgtctgaaaggtcagaagctgccg
aaaccggcgggactgatcactcagaacgagcagctgtgggagccgctgtacgcctgctat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgaactgctcgacaccctg
cgccgcatgaagtctttcggcgtaccgctggtgcgtattgatattcgtcaggaaagcacc
cgccataccgaagcgctgggtgaaatgacccgttacctcgggatcggcgactacgaaagc
tggtcggaagccgacaaacaggctttcctgatccgcgaactgaattccaaacgtccgctg
ctgccgcgccagtgggagccaagcgaagagacgcgtgaagttctcgacacctgcaaggtg
atcgccgaggcgccgcgcggatcgatctccgcctacgtgatctcgatggcaaaaacgccg
tccgatgtgctggcggttcatctcctgctgaaagaagccgggattggctttgctctgccg
gtggccccgctgttcgaaacgctggatgacctcaacaacgccaacgacgtcatgacccag
ctgctgaatatcgactggtaccgcggctttatccagggcaagcagatggtcatgatcggc
tactctgactccgctaaagatgccggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgaaaaagccggtattgaactgacgctgttccacggt
cgcggcggctctatcggccgcggcggcgcgccggcccacgccgcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtataccagcgccattctggaa
gccaacctgctgccgccgccggagccgaaagcagaatggcgcgacatcatggccgagctg
tccgacgtgtcgtgcaagatgtatcgcggctacgtgcgtgaaaacaaagatttcgtccct
tacttccgctctgcgaccccggagcaggagctgggcaaactgccgctgggttcgcgtccg
gcaaaacgtcgtccaaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgctggcgctgcgctgcagaag
gtggtcgaaggtggaaaacagagtgaactggaagccatgtgtcgcgactggccgttcttc
tctacccgcctcggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tactacgatcagcgcctggtgaagccggagctgtgggcgctgggttccgagctgcgcaag
ctgctggctgccgatatcaacgtcgtgctggccatcgccaacgactcccatctgatggcc
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggctgaagaagagggcaaggacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgtcgccgccggtatgcgt
aacaccggttaa

DBGET integrated database retrieval system