KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1024Help
Entry
KPR_1024          CDS       T02793                                 

Gene name
ddl
Definition
(GenBank) highly similar to D-alanine--D-alanine ligase from Salmonella paratyphi A (sp|B5BLC4)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00473  D-Alanine metabolism
kpr00550  Peptidoglycan biosynthesis
kpr01100  Metabolic pathways
kpr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KPR_1024 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_1024 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KPR_1024 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
    KPR_1024 (ddl)
Enzymes [BR:kpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KPR_1024 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
 Precursor biosynthesis
  Amino acid ligase
   KPR_1024 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: CCI75254
UniProt: R4Y9E5
LinkDB All DBs
Position
1074181..1075101
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLFGGTSAEREVSLNSGAAVLAGLREGGVDAHPVDPRDVDITQLKKQGFKKAFI
ALHGRGGEDGTLQGLLELIQLPYTGSGVMASAISMDKLRSKWLWQGAGLPVAPWVALTRA
QFAAGLSTDVEQQIAALGLPVIIKPSREGSSVGMSKVSERCDLASALALAFQHDDEVLVE
KWLSGPEFTVAIVGEEILPSIRIQAAGTFYDYEAKYLSDETQYFCPGFEDPARESAIQNL
VLKAWNVLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILDLAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtgcttttcggtggaacctccgctgaacgtgaagtgtcgctg
aattcaggcgcggcggtgctggccgggctgcgtgaaggcggggtggacgcccatccggtc
gacccgcgcgatgttgatattacccagctaaaaaagcagggctttaagaaagcgtttatt
gccctccacggccgcggcggggaagatggcactctgcaggggctgctggagttaatccag
ttgccttataccggcagcggcgtgatggcttcggcgatttcaatggataaactgcgcagc
aagtggctgtggcagggcgccggattaccggtcgcgccgtgggtggcgctgacccgcgcc
cagtttgccgccgggctgtctactgacgtcgaacagcaaattgcggcgctgggtctgccg
gtcatcatcaagccgagccgtgaaggctccagcgtcgggatgtcgaaagtcagcgaacgt
tgtgatttagcgagtgcattggcgttggcttttcagcatgatgatgaagttttggtcgaa
aaatggctcagtggaccggaatttaccgtcgccatagtcggtgaagaaattttaccgtca
atacgtatccaggccgcgggaaccttctatgattatgaggcgaagtatctctctgatgag
acgcaatatttctgcccaggatttgaagatcccgcgcgtgagtcagctattcagaacctg
gtgcttaaagcctggaatgttctgggttgcaaaggctggggccgtattgacgtgatgctg
gacagcgatggccagttttatctgctggaagcgaatacttccccgggcatgaccagccat
agccttgtgccaatggcggcgcgtcaggcaggaatgagcttctcccagcttgttgtacga
attctggacctggcggggtga

DBGET integrated database retrieval system