KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1095Help
Entry
KPR_1095          CDS       T02793                                 

Gene name
mrcB
Definition
(GenBank) highly similar to penicillin-binding protein 1B from Escherichia coli O6 (tr|Q8FL20)
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_1095 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kpr01003]
    KPR_1095 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
    KPR_1095 (mrcB)
Enzymes [BR:kpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     KPR_1095 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KPR_1095 (mrcB)
Glycosyltransferases [BR:kpr01003]
 Polysaccharide
  Bacterial polysaccharide
   KPR_1095 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   KPR_1095 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM UB2H Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: CCI75325
UniProt: R4YCB2
LinkDB All DBs
Position
1151545..1154112
Genome map
AA seq 855 aa AA seqDB search
MRRKSMAGDDREPIGRKGRPSRPTKQKVTRRRVREEDYDDEYDDDDYEDEKPVPRKAKGK
GGKPRRKRSWLWLLVKLGIVFAVLIAAYGVYLDQKIRSRIDGKVWELPAAVYGRMVNLEP
DMQISKNEMVRLLNATQYRQVSAMTRPGEYTVQANSIEMIRRPFDFPDSKEGQVRARLTF
DGDHLETIENMDNNRQFGFFRLDPRLITMLQSPNGEQRLFVKRSGFPDLLVDTLLATEDR
HFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMAL
IVDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVK
GASVYNPWRNPKLALERRNLVLRLLQQQQVIDQELYDMLSARPLGVQPRGGVISPQPAFM
QMVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAASEGIPVLKKQRKLADLETAMV
VVDRFTGEVRAMVGGAEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPNQYRLNTWIAD
APVTIRLSNGQTWSPQNDDRRFSGQVMLVDALTRSMNVPTVNLGMALGLPAVVDTWTKLG
APKNQLNAVPSMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGTVLYQSYPQ
AERAVPAQAAYMTLWTMQQVVQRGTGRQLGTKYPGLHLAGKTGTTNNNVDTWFAGIDGSQ
VTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLVLTVPEDVVDMGVDSNGNFVCS
GGMRSLLVWTTQPDALCRQGEMMQQQQLQQQEAKNPFNQSGQQQPPQQQQKQQPPKQQEK
SDGVAGWIKDMFGSN
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagaaaaagcatggcgggagatgaccgcgagcctatcggacgtaagggaagaccc
tcacgtccgactaaacagaaagtcacccgtcgccgggtccgggaagaggactacgacgac
gagtatgatgacgatgattatgaggatgagaaaccggtgccgagaaaagccaaaggcaaa
ggtggcaagcctcgtcggaagcgcagctggctgtggctgctggtcaagctggggattgtc
ttcgcggtgctgattgccgcctatggcgtctacctcgaccagaaaatccgcagccgcatt
gacggtaaagtctgggagctgccggccgcggtctatggccggatggtcaaccttgagccg
gacatgcagatcagcaaaaacgagatggtgcgtctgctcaacgccacgcagtatcgccag
gtcagcgcgatgacgcgccccggcgaatataccgtgcaggctaacagcatcgagatgatc
cgtcgtccgttcgatttcccggacagtaaggaagggcaggtgcgcgcgcgtcttaccttc
gacggcgaccatcttgagaccatcgagaatatggataataaccgccagttcggtttcttc
cgcctcgatccgcgccttatcaccatgctgcagtcgccgaacggcgagcagcgcctgttc
gtgaagcgcagcggcttccccgatctgctggtggataccctgctggcgaccgaagaccgc
cacttctatgagcacgatgggatcagtctctactccatcggccgcgcggtgctggcgaac
ctgacggcaggccgaacggtgcagggggcgagtaccctgacccaacagctggtgaaaaac
ctgttcctctccagcgaacgctcctactggcgtaaagccaacgaagcgtatatggcgctg
atcgtcgacgcccgctacagcaaggatcgcatccttgagctgtatatgaacgaggtgtac
ctcggccagagcggcgataacgaaattcgcggcttcccgctggccagcctgtattacttc
ggccgtccggtggaagagctgagcctcgaccagcaggcgctgctggtggggatggtgaaa
ggggcgtcggtctataacccgtggcgtaacccgaaactggcccttgaacgacgcaatctg
gtgctgcgtctgctgcagcagcagcaggttatcgaccaggagctgtacgacatgctcagc
gcccgtccgctgggcgtgcagccgcgcggcggggtgatttcaccgcagccggcgtttatg
cagatggttcgtcaggaactgcaggcgaagctgggcgataaagtgaaagatctttccggc
gtgaagatcttcaccactttcgactcggtggcgcaggatgcggcggaaaaagcggcctcc
gaagggatcccggttctgaagaaacagcgtaagctggcagacctggaaaccgccatggtg
gtggttgaccgcttcaccggcgaagtgcgggcgatggtcggcggcgcggagccgcagttc
gccggttataaccgcgcgatgcaggcccgccgatcgattggttctctggccaagccggcg
acctatctgaccgcgctgagccagccgaatcagtatcgcctgaatacctggatcgccgat
gcgccggtgacgattcgcctgtccaacggtcagacgtggtccccgcagaacgacgatcgt
cgtttcagcggtcaggtgatgctggtggatgccctgactcgctcgatgaacgtcccgacg
gttaacctcgggatggcgctgggcttgccggcggtagtcgatacctggactaaactgggg
gcgccgaagaatcagctcaacgcggtgccgtcgatgctgcttggcgcgctgaacctgacg
ccgattgaagtggcccaggccttccagaccatcgccagcggtgggaaccgtgcgccgctt
tccgcgctgcggtcagtgattgccgaagatggcactgtgctctaccagagctatccgcag
gcggagcgcgcggtgcctgcccaggcggcctacatgacgctgtggactatgcagcaggtg
gtgcagcgcggtacggggcgtcagctggggacgaagtatccgggcctgcatctggcgggg
aaaaccgggaccaccaacaataacgtcgatacctggttcgccggcatcgacggtagtcag
gtgaccatcacctgggtggggcgcgacaataaccagccgaccaaactgtacggcgccagc
ggcgcgatgtcgatttaccagcgctatctggcgaaccagacgccaacgccgctggtgctg
acggtgccggaagacgtggttgatatgggcgtggacagcaacggcaacttcgtctgcagc
ggcggtatgcgttcgctgctggtctggaccacgcagccggatgcgctgtgccgtcagggc
gaaatgatgcaacagcagcagttgcagcaacaggaagcgaaaaatccgtttaatcagtcc
gggcagcagcagccgccgcagcagcaacagaagcaacagccgccgaagcagcaggaaaag
agcgacggcgtcgcgggctggatcaaggatatgttcggcagtaactga

DBGET integrated database retrieval system