KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1124Help
Entry
KPR_1124          CDS       T02793                                 

Gene name
fabZ
Definition
(GenBank) highly similar to (3R)-hydroxymyristoyl-[acyl-carrier-protein dehydratase from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6T4Y2)
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00061  Fatty acid biosynthesis
kpr00780  Biotin metabolism
kpr01100  Metabolic pathways
kpr01212  Fatty acid metabolism
Module
kpr_M00083  Fatty acid biosynthesis, elongation
kpr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPR_1124 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPR_1124 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpr01004]
    KPR_1124 (fabZ)
Enzymes [BR:kpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KPR_1124 (fabZ)
Lipid biosynthesis proteins [BR:kpr01004]
 Fatty acid synthase
  Component type
   KPR_1124 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: CCI75354
UniProt: R4Y9N2
LinkDB All DBs
Position
1187871..1188326
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccctggtaagccgatt
ttgccgggcgtcctgattctggaagcaatggcgcaagccaccgggattctggcgttcaaa
agcgtcggaaaactggaaccaggcgagctgtactacttcgcgggtatcgatgaagcacgc
ttcaaacgcccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgttgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system