KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1189Help
Entry
KPR_1189          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to beta-galactosidase from Enterobacter cloacae (tr|D5CE53)
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPR_1189
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KPR_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: CCI75419
UniProt: R4Y9V1
LinkDB All DBs
Position
complement(1253416..1255473)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVCQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYQLVIAPMLYMVRDGFAGRAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVPHLCELIHIESAQALATYRDDFYAGRPAVTVNAFGKGKAWHVASRNDLA
FQRDFFTALSKELALPRAIATELPPGVVATARTDGDNAFIFLQNYSAQNHTLTLPQGYRD
CLTDAAVSAPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccacgc
gaaggggtatttaatttcgcctggctggatattatcctcgataaactgtatgccgccggc
attcatgtctttctggccacgccgagcggcgcgcgtccggcgtggatgtcgcagcgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgcaaatcaataccctgctggca
gaacgttattcctcacacccggcggtgctgggctggcatatttccaacgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctatactgac
tggtcgcagattgaatcgcctgcgccgcagggcgagatgtcgatccacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgctccg
ctgaaggcggcgaatgcttccctgccggtgactaccaactttatggagtatttctacgat
tacgactactggcagctggcggaggcgctggatttcatctcctgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgttacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccaccccgggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctttcctcgctacag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcagttgtcgaccacgtcggacatattgatacccgcattggc
cgcgaagtctgccagctcggcgagatcctcagcaagctgccggaggtgaggggctgtcgc
accgaggcgaaagtagcgattatcttcgaccagcagaaccgctgggcgctggatgacgcc
caggggccgcgtaatcttgggatggaatatgagaagacggtcaacgagcactaccgcccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgatgtcgatttaacgccgtat
cagttagtgattgccccgatgttatatatggtgcgcgacggctttgccggtcgggcggag
gcgtttgtcgccaacggcggccacctggtgaccacctactggaccggtatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatttgctggggatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctggtgcaggggcttgccggg
aatcagtgcggtctgcagggcccttatcaggtgccccatctctgcgaactgatccatatc
gagagcgcccaggcgctggccacctaccgggatgatttttatgccggacggccggctgtg
acggtgaacgcgttcgggaaaggcaaagcctggcatgtggcctcccgcaacgatttagcc
ttccagcgcgatttctttaccgccctgagcaaggagctggccctgccgcgggcgatagcg
acggagttaccacccggcgtggtggcgactgcgcgcaccgacggtgacaacgcatttatc
ttcctgcagaactacagcgcgcaaaaccataccctgaccctgccgcaagggtatcgggat
tgcctgaccgacgcggcggtatcggctccactgaccctgtcggcatgggattgccgtatt
ctccgtcgtcacgcgtaa

DBGET integrated database retrieval system