KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2189Help
Entry
KPR_2189          CDS       T02793                                 

Gene name
icdA
Definition
(GenBank) hihly similar to isocitrate dehydrogenase [NADP] from Escherichia coli O6 (tr|Q8FIB3)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00020  Citrate cycle (TCA cycle)
kpr00480  Glutathione metabolism
kpr01100  Metabolic pathways
kpr01110  Biosynthesis of secondary metabolites
kpr01120  Microbial metabolism in diverse environments
kpr01130  Biosynthesis of antibiotics
kpr01200  Carbon metabolism
kpr01210  2-Oxocarboxylic acid metabolism
kpr01230  Biosynthesis of amino acids
Module
kpr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPR_2189 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPR_2189 (icdA)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KPR_2189 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CCI76419
UniProt: R4Y7T2
LinkDB All DBs
Position
2290232..2291482
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtccctcacaatccgattatcccgttcattgaaggtgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgagaaatcaacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcattcgttctctgaacgtggcgctgcgccag
gagctggacctctacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaagcaccctgaactgaccgatatggttatcttccgtgaaaactcagaagatatctat
gccggtatcgagtggaaagccgactctgcggaagcagacaaagtcatcaaattcctgcgc
gatgagatgggcgtgaagaaaattcgcttcccggaacattgcggtatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggttcgcgccgcgattgaatacgcgatcactaac
gatcgtgattccgtcactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactacatctctgacgccctggcggcgcaggttggcggtatc
ggtatcgccccgggcgccaacatcggcgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagaatttggcgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system