KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2375
Entry
KPR_2375          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; similar to short-chain dehydrogenase/reductase SDR from Burkholderia graminis (tr|B1FX37)
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 HEAT_2
Other DBs
NCBI-ProteinID: CCI76605
UniProt: R4Y8Y8
LinkDB
Position
2471275..2472036
AA seq 253 aa
MHNSAKIALVTGGSRGLGRATVEALAQRGVNVVLTYKTRLAEANEVVTRVEALGARAIAL
PFSAGEIDTFDAFVSAFQGALTELGADKFDYLVNNAGNASGMGFLNATEAEFDALYRIHV
KSVFFLSQKLLPLLADGGRIVNVSSGLTRIVMANRAPYAIMKSAVETLTRYMAFELGSRG
ITVNCVAPGAIATDFSGGVVRDNPQVAQAVAAMTALGRPGLPEDIGPMIASLLSDDHRWV
NAQRIEVSGGMRI
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcacaatagcgcaaaaatcgccctggtgacaggcggcagccgcggcctgggacgcgcg
accgtcgaagcgctggcacagcgcggcgtaaatgtagtactgacctacaaaacgcgtctt
gccgaggcgaacgaggtggttacacgggttgaagcactgggcgcccgggcgatcgcgttg
cctttcagcgccggcgaaatcgatacctttgacgcatttgttagcgcttttcagggcgcg
ctgacggagctgggcgccgataaatttgattatctggtcaataatgccggcaacgccagc
ggcatgggatttcttaacgccacagaagcggaattcgatgcgctgtatcgcatccacgtg
aagagcgtttttttcctcagccaaaaactattgccgctgctggccgatggcgggcgaata
gtgaatgtctcgtccggcctcacccgcatcgtgatggcgaaccgggcgccctatgcgatc
atgaaatccgcggtggaaaccctgactcgctatatggcgtttgagctgggcagtcgcggg
atcacggtgaactgcgtggcgcccggcgccatcgccaccgatttcagcggcggggtggtg
cgggataacccgcaggtcgctcaggctgtcgctgcgatgacggccctgggccgacctggc
ctgccagaggatatcgggccgatgatcgcctcgctgttatccgatgatcatcgctgggtg
aatgcccagcgcattgaggtttccgggggaatgcgcatctga

DBGET integrated database retrieval system