KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2413Help
Entry
KPR_2413          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to N-terminal region of penicillin-binding protein 2 from Serratia odorifera (tr|D4E673)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00550  Peptidoglycan biosynthesis
kpr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_2413
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    KPR_2413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
    KPR_2413
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KPR_2413
Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   KPR_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CCI76643
UniProt: R4Y8U3
LinkDB All DBs
Position
2510528..2511370
Genome map
AA seq 280 aa AA seqDB search
MPLLRDEIRDHSAEEMLFIRRAAIAFLLVVVCFGVLIVNLYHLQVEQHDFYQTRSNQNDI
KMLPIAPSRGLIFDRNGIPLVQNITLYRLQVIPSKIPDMAALLQQLTPIVDLTPDDIASF
RDDMHHTSRYKAVTLKSDLSDVEVARFAVNEFRFPGVTVESYQQREYPYGAELAHVVGYV
SKINDSDLQRLAKNGEEENYAADRNIGKQGIEGYYEKALHGTTGYQEVEVDNHGRVVRLL
KEVPPVAGPTARAILDHIFVPQQASSAAADVPQRDSADAQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccccttttgagagacgaaattcgcgaccactccgcggaagagatgctgtttatccgc
cgggccgcaattgcttttctgctggtggtggtctgctttggcgtgctgatcgttaacctc
taccatctgcaggtggagcagcacgatttttaccagacccggtcaaaccagaacgacatc
aaaatgctgcccatcgcccccagccgcgggctgatattcgatcgcaacggcattccgctg
gtgcagaatatcaccctgtatcgcctgcaggtgatcccgagcaaaattcccgatatggcc
gcgctgttgcagcagctgacgcctatcgtcgacctgacgccggacgacatcgccagcttt
cgcgacgatatgcaccacaccagccgctacaaagcggtcaccctcaagtcagacctcagc
gatgtggaggtggcccgcttcgcggtcaacgaattccgtttccccggcgtgacggtggag
agctaccaacaacgggaatacccctacggcgcagagctggcgcacgtggtgggctatgtg
tcgaaaatcaacgacagcgatctgcagcggctggcgaaaaacggcgaagaggagaactac
gccgccgaccgcaatatcggtaagcagggcatcgagggctattatgaaaaagcgctccac
ggcaccaccggctatcaggaagtggaggtggataaccacggccgggtggtgcgtctactg
aaagaggtgccgccggtggccggaccgacggcgcgcgccatcctggaccatatttttgtc
ccgcagcaggcatcttcggcggcagccgatgtgccgcagcgtgatagcgccgatgcccag
taa

DBGET integrated database retrieval system