KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3713Help
Entry
KPR_3713          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to D-alanyl-D-alanine carboxypeptidase fraction A from Escherichia coli B354 (tr|D6J8F1)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00550  Peptidoglycan biosynthesis
kpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_3713
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kpr01002]
    KPR_3713
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
    KPR_3713
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KPR_3713
Peptidases [BR:kpr01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KPR_3713
Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KPR_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CCI77941
UniProt: R4YBY4
LinkDB All DBs
Position
complement(3809180..3810412)
Genome map
AA seq 410 aa AA seqDB search
MFGKDTWVALMMHDAFSLRGLAAGCALLFLVAPAVQAAEQLPDAPSIDARAWILMDYASG
KVLSEGNADEKLDPASLTKIMTSYVVGQAIKAGKIKLTDMVTVGRDAWATGNPALRGSSV
MFLKPGMQVSVEDLNKGVIIQSGNDASIAIADYVAGSQDAFVSLMNGYAKKMGLTNTTFM
TVHGLDAPGQFSTARDMALLTKAMIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSSNLN
ADGVKTGTTAGAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFFETVTP
IKPDATFVTQRVWFGDSNEAKLGAGEAGSITLPKGQLKNLKASYTLNQPQLTAPLEKGQV
VGTIDFKLNDKTIEQRPLIVMESVKEGGFFSQMIDFVLMKLHGWFGSWFS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggaaaggatacttgggtggctcttatgatgcatgacgctttttcccttcgcggc
ctcgcggcaggttgcgcgctgttatttcttgtcgcacctgcggtgcaggctgcggaacaa
ctccccgacgccccttcaattgacgctcgcgcctggatcctgatggactatgccagcggg
aaggtgctcagcgaaggcaatgccgatgaaaaactcgacccggccagtctgacgaagatc
atgaccagctacgtggtagggcaggcaataaaagcgggaaaaatcaaactgaccgatatg
gtgaccgttgggcgcgatgcctgggcgaccggcaacccggcgctgcgcggctcatcggtg
atgttcctcaagcctggcatgcaggtttccgtagaagatctgaacaaaggggtcatcatt
cagtccggtaacgacgccagcattgcgattgctgactacgtagcgggcagccaggacgct
ttcgttagcctgatgaacggctacgccaaaaaaatggggctgaccaacaccacctttatg
accgtccacggccttgacgcgccggggcagttcagcaccgcccgcgatatggcgctgctg
accaaagcgatgatccacgacgtaccggaagagtatgcggtacataaagagaaagagttc
actttcaataaaattcgccagccgaaccgcaaccgcctgctgtggagcagtaacctcaac
gccgatggcgtgaaaaccgggaccaccgccggggccggctataacctcgtctcctcggcc
actcagggtgatatgcgtttgattgccgtggtgctggggaccaaaaccgaccgcattcgc
tttaacgagtcagaaaaactgctgacctggggcttccgcttctttgaaaccgtgacgccg
attaaaccagatgccaccttcgttacccagcgcgtgtggtttggcgatagcaatgaagcg
aaactgggggctggcgaggcgggctctatcactttgccgaagggccaactgaaaaacctg
aaagccagctataccttaaatcagccgcagcttaccgctccgctggagaaggggcaggtg
gtcgggactatcgactttaagctaaatgataaaaccattgaacagcgtccgctgattgtc
atggagtcggtaaaagagggcggcttcttcagccagatgatcgacttcgtgctgatgaaa
ctgcacggctggttcggcagctggttctcctga

DBGET integrated database retrieval system