KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3925Help
Entry
KPR_3925          CDS       T02793                                 

Gene name
ahpF
Definition
(GenBank) highly similar to alkyl hydroperoxide reductase subunit F from Salmonella typhimurium (sp|P19480)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPR_3925 (ahpF)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KPR_3925 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin DAO FMO-like NAD_binding_9 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CCI78153
UniProt: R4YDD4
LinkDB All DBs
Position
complement(4037842..4039407)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaagcct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagtcacctttaaagaagacaacacgctcgcggta
cgtaagccctcgttcctgattactaacccaggttccgaccaggggccgcgttttgcgggc
tcgccgctgggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatattgatggcgatttcgaa
ttcgaaacctactattcgctctcctgtcataactgcccggacgtggtccaggccctgaac
ctgatggcggtgctcaacccgcgcatcaaacacacggcgattgacggcgggaccttccag
aatgagatcaccgagcgtaacgtcatgggcgtgccagcggtgttcatgaacggtcaggag
tttggtcagggacggatgacgctgactgaaatcgtcgccaaagtggataccggtgcggaa
aaacgcgcagcggaagagctgaatcagcgtgacgcttacgatgtactgatcgttggctcc
ggcccgtccggcgcggcggcggcggtctactctgcacgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatttcg
gtgccgaaaactgaaggccagaagctggcaggcgcgctgaaagcgcacgtcaatgactat
aacgtagacgtgatcgactcccagagtgcgaccaaactgacgccggcggcgacagagggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctcaaggcgcgtagcgtcatcatc
gccaccggggcgaaatggcgcaatatgaacgtgccgggcgaagaacagtatcgcaccaag
ggcgtgacctactgccctcactgcgatggtccgctgtttaagggcaaacgcgtagcggta
atcggcggcgggaactccggcgtggaagccgccattgacctggcgggcgtagtggagcac
gtaaccctgctggagtttgccccagagatgaaagccgaccaggtgttgcaggataaagtc
cgcagcctgaagaatgtcgacatcattcttaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtcaccggtctgcagtatcgtgaccgggtgagcggcgatgagcatcatgtc
gcgctggcggggatcttcgtccagattggcctgctgcctaacaccacctggctggaaggc
gccgttgagcgcaaccgcatgggcgagatcatcatcgatgcgaagtgcgaaaccaacgtc
aaaggcgtgttcgccgcgggcgattgcaccaccgtgccgtacaaacagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgctttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system