KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_5093Help
Entry
KPR_5093          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to 4-aminobutyrate aminotransferase from Escherichia coli strain K12 (sp|P50457)
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00250  Alanine, aspartate and glutamate metabolism
kpr00410  beta-Alanine metabolism
kpr00640  Propanoate metabolism
kpr00650  Butanoate metabolism
kpr01100  Metabolic pathways
kpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPR_5093
   00650 Butanoate metabolism
    KPR_5093
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPR_5093
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPR_5093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpr01007]
    KPR_5093
Enzymes [BR:kpr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPR_5093
Amino acid related enzymes [BR:kpr01007]
 Aminotransferase (transaminase)
  Class III
   KPR_5093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCI79321
UniProt: R4YGB5
LinkDB All DBs
Position
5216520..5217785
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVAEQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggtagccgagcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccggggctgattaccttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggcgtttaccccaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcattctcgagccgatccaaggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagagcagctgtgc
cagcgcgctgaacagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgttgatgtccgcggccgggggtcgatggtggcagtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgccaggtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ctgacgattccggatgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system