KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00304Help
Entry
KPNJ2_00304       CDS       T03177                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00250  Alanine, aspartate and glutamate metabolism
kps00410  beta-Alanine metabolism
kps00640  Propanoate metabolism
kps00650  Butanoate metabolism
kps01100  Metabolic pathways
kps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNJ2_00304
   00650 Butanoate metabolism
    KPNJ2_00304
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPNJ2_00304
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPNJ2_00304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kps01007]
    KPNJ2_00304
Enzymes [BR:kps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPNJ2_00304
Amino acid related enzymes [BR:kps01007]
 Aminotransferase (transaminase)
  Class III
   KPNJ2_00304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHM77084
UniProt: W8UB16
LinkDB All DBs
Position
314156..315448
Genome map
AA seq 430 aa AA seqDB search
MTYTTGDSQVKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAV
LNTGHRHPKVVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGA
EAVENAVKIARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYP
NAAHGVTTADALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTH
GILLIADEVQTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPG
GLGGTYAGNPLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRG
SMVAVEFNDPQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKA
LDILARVLKS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgacatacacgacaggagattcgcaggtgaaaagctcagaactgaatcaacgtcgccag
caggcgacgccgcgcggcgtaggcgtaatgtgtaactactttgtcgagaaggcggaaaac
gccacgctgtgggatatcgaaggcaatgaggtgatcgatttcgccgccgggatcgccgtg
ttaaataccggtcaccgccatccgaaagtggtcgccgcggttgccgaccagctgcaggcg
ttcacccacaccgcctatcagattgtgccgtacgaaagctatgtttcgctggcggagcgt
atcaacgatctggcgccaattgacgggccggcaaaaacggctttcttcaccaccggcgcg
gaagcggtcgagaacgcggtgaaaatcgcccgcgcttacaccggtcgtccggggctgatt
accttcggcggcggtttccacggccgtacctttatgaccatggccctcaccggtaaggtc
gcgccctacaaaatcggcttcgggccattcccgggctcggtgtatcacggcgtttacccc
aatgcggcgcatggcgtgaccaccgcggatgcgctgaaaagcctggagcgcattttcaaa
gcggatattgcgccggaccaggtagcggccatcattctcgagccgatccagggggaaggc
ggctttaacgtcgcgccggccgattttatgcaggcgctgcgcgacctgtgcgatacccac
ggcattctgctgatcgccgatgaagtgcagaccggtttcgcccgcaccggcaagctgttc
gctatgcagcactatgaggtgaaaccggatctgatgacgatggcgaaaagcctcgccggc
ggtttcccgctgtcgggcgttgtcggccgcgccgaggtgatggatgcgccagccccaggc
gggctgggcggaacctatgccggtaacccgctggcggtggccgcggcgcacgcggtgctg
gatgtgattgccgaagagcagctgtgtcagcgcgctgaacagctgggtagccatctgcag
gaagtgctcaaccaggcgcgcgctacctgcccggcgatcgtagatgtccgcggccggggg
tcgatggtggcggtggagtttaacgatccgcaaacaggcgaaccgtcgccggaattcacc
cgccttgtgcaacagaaagcgcaggagaacggcctgctgctgctgagctgtggcgtctac
ggcaacgtgatccgcttcctgtatccgttgactatccccgacgcccagttctcgaaagcg
ctggatattctggcgcgcgtactgaagagctaa

DBGET integrated database retrieval system