KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00415Help
Entry
KPNJ2_00415       CDS       T03177                                 

Definition
(GenBank) Protein translation elongation factor Tu (EF-TU)
  KO
K02358  elongation factor Tu
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Brite
KEGG Orthology (KO) [BR:kps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kps03012]
    KPNJ2_00415
   03029 Mitochondrial biogenesis [BR:kps03029]
    KPNJ2_00415
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kps04147]
    KPNJ2_00415
Translation factors [BR:kps03012]
 Eukaryotic Type
  Elongation factors
   KPNJ2_00415
 Prokaryotic Type
   KPNJ2_00415
Mitochondrial biogenesis [BR:kps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KPNJ2_00415
Exosome [BR:kps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KPNJ2_00415
  Exosomal proteins of breast cancer cells
   KPNJ2_00415
  Exosomal proteins of colorectal cancer cells
   KPNJ2_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AHM77195
UniProt: W8UNN8
LinkDB All DBs
Position
424105..425289
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIN
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactaccgttctggctaaaacctac
ggtggttctgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggccacctggatacctatatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctctggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtaggt
gaagaagttgaaatcgttggtatcaaagaaaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaac
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggtcgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system