KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00639
Entry
KPNJ2_00639       CDS       T03177                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00052  Galactose metabolism
kps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNJ2_00639
Enzymes [BR:kps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     KPNJ2_00639
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_25 2-Hacid_dh_C Methyltransf_31 MTS UDPG_MGDP_dh_N 3HCDH_N Methyltransf_24 PrmA CoA_binding Methyltransf_11 Pyr_redox_2 ELFV_dehydrog Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: AHM77419
UniProt: W8UBX5
LinkDB
Position
complement(633569..634612)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATHVFNSREMSGQAIQQALESIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLLAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFARAVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatcccc
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccgggttatgcggctcc
gatatcccgcgcattttcgccaaaggggcgcattactaccctattacgctggggcacgaa
ttcagcggttatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccttgcttccagtgcccgcaatgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgatggc
gcgtttatcgaaccgataaccgttggcctgcacgcttttcatctggcgcagggctgtgaa
ggtaaaaacgtgattattatcggcgccggcaccatcggcctgctggcgctacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaagctggagctg
gccaaaaccctcggcgcaacccatgtgttcaacagtcgcgagatgagcggccaggcgatt
cagcaggcgctggaatccattcagttcgaccagttagtcctcgagaccgccggtacgccg
cagaccgtcgcgctggcgattgaggccgccggtccgcgggcgcagctggcgttggttggc
acgcttcatcacgatttaaccctcctggcagccaccttcgggcagattctgcgtaaggag
ttgaatattgtgggtagctggatgaactactctggcccgtggccgggagaagagtggcaa
acggccacccgtctgctgactgaaaaacgcctgcagctggcgccgctgatcgcccatcgt
ggcgacgcagaaagcttcgctcgtgcagtgcaggcgctcaacggcgcgccaatgcaaggc
aaaatcctgctcaaactctcttga

DBGET integrated database retrieval system