KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00912Help
Entry
KPNJ2_00912       CDS       T03177                                 

Definition
(GenBank) Transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00030  Pentose phosphate pathway
kps01100  Metabolic pathways
kps01110  Biosynthesis of secondary metabolites
kps01120  Microbial metabolism in diverse environments
kps01130  Biosynthesis of antibiotics
kps01200  Carbon metabolism
kps01230  Biosynthesis of amino acids
Module
kps_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kps_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPNJ2_00912
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    KPNJ2_00912
Enzymes [BR:kps01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     KPNJ2_00912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AHM77692
UniProt: W8UUU7
LinkDB All DBs
Position
884242..886350
Genome map
AA seq 702 aa AA seqDB search
MYMTCRLGYIVHTFFRRSPKRALVKSLRAWPSTVRTGVKMSSRKELANAIRALSMDAVQK
AKSGHPGAPMGMADIAEVLWRDFLNHNPNNPAWADRDRFVLSNGHGSMLIYSLLHLTGYD
LPIEELKNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGIANAVGMAIAEKTLAAQFNRPG
HDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLVAFYDDNGISIDGHVEGWFTDDT
AKRFEAYGWHVVRGVDGHDADAIKRAVEEARAVTDKPSLLMCKTIIGFGSPNKAGTHDSH
GAPLGDAEIALTREALGWKHAPFDIPSDIYAQWDAKEAGQAKEAAWNEKFAAYAKAFPQE
AAEFTRRMKGEMPSDFDAKANEFIAKLQANPAKIASRKASQNAIEAFGPLLPEFLGGSAD
LAPSNLTLWSGSKPINEDAAGNYIHYGVREFGMTAIANGIALHGGFLPYTSTFLMFVEYA
RNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAI
AWKYGVERQDGPTALILSRQNLAQQERTAEQLANVARGGYVLKDCAGQPELIFIATGSEV
ELAVAAWDKLTAEGVKARVVSMPSTDAFDKQDAAYRESVLPKDVTARVAVEAGIADYWFK
YVGLNGAIVGMTTFGESAPAEQLFEEFGFTVDNVVAKAKALL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgacttgtcgcttgggttacattgttcacacttttttccggcgtagcccaaaa
cgcgctctcgtcaagtcgttaagggcatggccttcaacagtccgaactggagtcaaaatg
tcctcacgtaaagagcttgctaacgctattcgtgcgctgagcatggacgctgtacagaaa
gccaaatccggccacccgggggccccgatgggtatggctgacattgccgaagtgctgtgg
cgtgatttcctgaaccataacccgaacaatccggcctgggctgaccgtgaccgttttgtg
ttgtcaaatggccatggttcgatgctgatttacagcctgctgcacctcactggctacgat
ctgccgattgaagagctgaaaaacttccgccagctgcactccaaaaccccgggtcacccg
gaagtcggctacaccgcaggcgtggaaaccaccaccggtccgctgggccagggtatcgct
aacgcggtcgggatggctatcgccgagaaaaccctggcggcgcagttcaaccgtccggga
cacgatatcgtcgaccactacacctacgccttcatgggcgacggctgcatgatggaaggc
atttctcacgaagtgtgctccctggccggtaccctgaaactgggtaaactggtggcgttc
tatgatgacaacggcatctctatcgacggccacgttgaaggctggttcaccgatgacacc
gcgaaacgctttgaagcctacggctggcacgtggtgcgcggcgtggacggtcacgacgct
gacgccatcaaacgcgcggtagaagaagcgcgggcggtcaccgacaaaccgtccctgctg
atgtgcaagaccatcatcggtttcggttcgccgaacaaagccggcacccacgactcccac
ggcgcgccgctgggcgacgccgaaatcgccctgacccgcgaagcgctgggctggaaacac
gcgccgtttgacatcccgtctgacatctatgcccagtgggatgccaaagaagccggccag
gcgaaagaagccgcatggaacgagaagtttgcggcttacgccaaagccttcccgcaggaa
gcagccgaattcacccgccgtatgaaaggcgagatgccgtctgacttcgacgcgaaagct
aacgagttcatcgcgaagctgcaggccaacccggcgaaaatcgccagccgtaaagcctcg
cagaacgccatcgaagctttcggcccgctgctgccggaattcctcggcggctccgcagat
ctcgcgccgtccaacctgaccctgtggtctggctctaagccgatcaacgaagacgctgcc
gggaactacatccactacggcgtgcgcgagttcggtatgaccgctatcgccaacggtatc
gcgctgcacggcggcttcctgccgtacacctccaccttcctgatgttcgtggaatacgcg
cgtaacgcggtacgtatggccgcgctgatgaaacagcgtcaggtgatggtctacacccac
gactcgatcggtctgggcgaagacggcccgactcaccagccggtagagcaggtggcttcc
ctgcgcgtgaccccgaacatgtccacctggcgtccgtgtgaccaggttgaatccgcgatt
gcgtggaaatatggcgtggagcgtcaggacggcccgaccgcgctgatcctctcccgtcag
aacctggcgcagcaggagcgtaccgcagagcagctggcgaacgtggcccgcggcggttat
gtgctgaaagattgcgccggccagccggagctgatcttcatcgccaccggttcagaagtg
gagctggcggttgccgcatgggacaaactgactgccgaaggcgtgaaggcgcgcgtggtt
tccatgccgtccaccgacgcgttcgacaagcaggatgcggcttatcgcgaatccgtactg
ccgaaagacgtgaccgcgcgcgttgccgtggaagcgggtatcgctgactactggttcaaa
tacgttggcctgaacggcgctatcgttggcatgaccaccttcggtgagtctgcgccggct
gagcagctgttcgaggagttcggcttcaccgttgataacgtggttgctaaagcgaaagcg
ctgctgtaa

DBGET integrated database retrieval system