KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_02207Help
Entry
KPNJ2_02207       CDS       T03177                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00240  Pyrimidine metabolism
kps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPNJ2_02207
Enzymes [BR:kps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KPNJ2_02207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AHM78987
UniProt: W8UYI4
LinkDB All DBs
Position
2166747..2167385
Genome map
AA seq 212 aa AA seqDB search
MIGVTQPMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRI
GLSSPARLYNPQTSLFDDIAAEHQLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLC
YGLRTDFRGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIG
GNERYVSVCRKHYKEALSVGSLTKVQNQHRPC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgattggggtcacgcagccgatggcacaactttatttctactactctgcaatgaatgca
ggtaagtcgaccgctctgttgcaatcttcgtacaattaccaggagcgggggatgcgtacc
gtcgtttataccgctgagattgatgaccgctttggcgccggaaaagtcagttcgcgtatc
gggctctcctcgccggcccgattgtataatccacagacctcgttatttgacgatattgcg
gcggagcaccagctaaagccgattcactgcgtgctggtggatgaaagccagtttctgacg
cgtgaacaggttcatgagctgtccgaagttgtcgatacgctggatattccggtgctttgc
tatgggttgcggacggactttcgcggtgagctctttaccggcagccagtatttactggcc
tggtcagataagctggttgagctgaaaacgatctgcttctgcggccgcaaggccagcatg
gtattgcgcctcgatcaggaggggcgtccttataatgagggtgagcaggtcgtcatcggc
ggtaatgagcggtacgtatcggtctgccgtaagcattataaagaggcgctgagcgtcggt
tcgttaaccaaggtacaaaaccagcaccgtccctgctga

DBGET integrated database retrieval system