KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_03919Help
Entry
KPNJ2_03919       CDS       T03177                                 

Definition
(GenBank) Peroxiredoxin reductase AhpF subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Brite
KEGG Orthology (KO) [BR:kps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPNJ2_03919
Enzymes [BR:kps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KPNJ2_03919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin DAO FMO-like NAD_binding_9 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AHM80699
UniProt: W8ULE5
LinkDB All DBs
Position
complement(3786490..3788055)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHIALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaagcct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagtcacctttaaagaagacaacacgctcgcggta
cgtaagccctcgttcctgattactaacccaggttccgaccaggggccgcgttttgcgggc
tcgccgctgggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatattgatggcgatttcgaa
ttcgaaacctactattcgctctcctgtcataactgcccggacgtggtccaggccctgaac
ctgatggcggtgctcaacccgcgcatcaaacacacggcgattgacggcgggaccttccag
aatgagatcaccgagcgtaacgtcatgggcgtgccagcggtgttcatgaacggtcaggag
tttggtcagggacggatgacgctgactgaaatcgtcgccaaagtggataccggtgcggaa
aaacgcgcagcggaagagctgaatcagcgtgacgcttacgatgtactgatcgttggctcc
ggcccgtccggcgcggcggcggcggtctactctgcacgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatttcg
gtgccgaaaaccgaaggccagaagctggcaggcgcgctgaaagcgcacgtcaatgactat
aacgtcgacgtgatcgactcccagagtgcgaccaaactgacgccggcggcgacagagggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctcaaggcgcgtagcgtcatcatc
gccaccggggcgaaatggcgcaatatgaacgtgccgggcgaagatcagtatcgcaccaag
ggcgtgacctactgccctcactgcgatggtccgctgtttaagggcaaacgcgtagcggta
atcggcggcgggaactccggcgtggaagccgccattgacctggcgggcgtcgtagagcac
gtaaccctgctggagtttgccccagagatgaaagccgaccaggtgttgcaggataaagtc
cgcagcctgaagaatgtcgacatcattcttaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtcaccggcctgcagtatcgtgaccgggtgagcggcgatgagcatcatatc
gcgctggcggggatcttcgtccagattggcctgctgcctaacaccacctggctggaaggc
gccgttgagcgcaaccgcatgggtgagatcatcatcgatgcgaagtgcgaaaccaacgtc
aaaggcgtgttcgccgcgggcgattgcaccaccgtgccgtacaaacagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgctttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system