KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_04479Help
Entry
KPNJ2_04479       CDS       T03177                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00061  Fatty acid biosynthesis
kps00780  Biotin metabolism
kps01100  Metabolic pathways
kps01212  Fatty acid metabolism
Module
kps_M00083  Fatty acid biosynthesis, elongation
kps_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPNJ2_04479
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPNJ2_04479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kps01004]
    KPNJ2_04479
Enzymes [BR:kps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KPNJ2_04479
Lipid biosynthesis proteins [BR:kps01004]
 Fatty acid synthase
  Component type
   KPNJ2_04479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AHM81255
UniProt: W8UQB9
LinkDB All DBs
Position
complement(4322965..4323492)
Genome map
AA seq 175 aa AA seqDB search
MHSLKDCRRPCYYCLLVHLDRKSILTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGR
FLRAVKNVSVNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGI
DEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
ttgcattcgctaaaagattgccgcaggccgtgttattattgccttttagtacatttagac
aggaagagtattttgactactgacactcatactctgcacattgaagagattctggaactt
ctgcctcaccgttacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgt
tttctgcgcgcagtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccct
ggtaagccgattttgccgggcgtcctgattctggaagcaatggcgcaagccaccgggatt
ctggcgttcaaaagcgtcggaaaactggaaccaggcgagctgtactacttcgcgggtatc
gatgaagcacgcttcaaacgcccggtagtaccaggcgatcagatgattatggaagtcact
ttcgagaaaacccgccgcggcctgacccgtttcaaaggcgttgcgctggttgacggtaaa
gtggtttgcgaagcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system