KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_04592Help
Entry
KPNJ2_04592       CDS       T03177                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00473  D-Alanine metabolism
kps00550  Peptidoglycan biosynthesis
kps01100  Metabolic pathways
kps01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KPNJ2_04592
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPNJ2_04592
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KPNJ2_04592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kps01011]
    KPNJ2_04592
Enzymes [BR:kps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KPNJ2_04592
Peptidoglycan biosynthesis and degradation proteins [BR:kps01011]
 Precursor biosynthesis
  Amino acid ligase
   KPNJ2_04592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AHM81368
UniProt: W8V0A9
LinkDB All DBs
Position
complement(4437494..4438414)
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLFGGTSAEREVSLNSGAAVLAGLREGGVDAHPVDPRDVDITQLKKQGFKKAFI
ALHGRGGEDGTLQGLLELIQLPYTGSGVMASAISMDKLRSKWLWQGAGLPVAPWVALTRA
QFAAGLSTDVEQQIAALGLPVIIKPSREGSSVGMSKVSESCDLASALALAFQHDDEVLVE
KWLSGPEFTVAIVGEEILPSIRIQAAGTFYDYEAKYLSDETQYFCPGFEDPARESAIQNL
VLKAWNVLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILDLAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtgcttttcggtggaacctccgctgaacgtgaagtgtcgctg
aattcaggcgcggcggtgctggccgggctgcgtgaaggcggggtggacgcccatccggtc
gacccgcgcgatgttgatattacccagctaaaaaagcagggctttaagaaagcgtttatt
gccctccacggccgcggcggggaagatggcactctgcaggggctgctggagttaatccag
ctgccttataccggcagcggcgtgatggcttcggcgatttcaatggataaactgcgcagc
aagtggctgtggcagggcgccggattaccggtcgcgccgtgggtggcgctgacccgcgcc
cagtttgccgccgggctgtctactgacgtcgaacagcaaattgcggcgctgggtctgccg
gtcatcatcaagccgagccgtgaaggctccagcgtcgggatgtcgaaagtcagcgaaagt
tgtgatttagcgagtgcattggcgttggcttttcagcatgatgatgaagttttggtcgaa
aaatggctcagtggaccggaatttaccgtcgccatagtcggtgaagaaattttaccgtca
atacgtatccaggccgcgggaaccttctatgattatgaggcgaagtatctctctgatgag
acgcaatatttctgcccaggatttgaagatcccgcgcgtgagtcagctattcagaacctg
gtgcttaaagcctggaatgttctgggttgcaaaggctggggccgtattgacgtgatgctg
gacagcgatggccagttttatctgctggaagcgaatacttccccgggcatgaccagccat
agccttgtgccaatggcggcgcgtcaggcaggaatgagcttctcccagcttgttgtacga
attctggacctggcggggtga

DBGET integrated database retrieval system