KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_1165Help
Entry
VK055_1165        CDS       T03418                                 

Gene name
fabI
Definition
(GenBank) NADH-dependent enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00061  Fatty acid biosynthesis
kpt00780  Biotin metabolism
kpt01100  Metabolic pathways
kpt01130  Biosynthesis of antibiotics
kpt01212  Fatty acid metabolism
Module
kpt_M00083  Fatty acid biosynthesis, elongation
kpt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VK055_1165 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VK055_1165 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    VK055_1165 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpt01004]
    VK055_1165 (fabI)
Enzymes [BR:kpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     VK055_1165 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     VK055_1165 (fabI)
Lipid biosynthesis proteins [BR:kpt01004]
 Fatty acid synthase
  Component type
   VK055_1165 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIK79788
UniProt: A0A1Y0Q1M7
LinkDB All DBs
Position
1170765..1171553
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSDIV
LPCDVAEDESITALFTELEKVWPKFDGFVHSIGFAPADQLDGDYVDVVTRDGFKIAHDIS
AYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGI
SGEVVHVDGGFNIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattttgatcactggcgtcgccagcaaactgtccatc
gcctacggcatcgcgcaggcaatgcaccgcgaaggcgcggaactggcattcacctatcag
aatgagaaactgaaaggtcgcgtagaagagtttgctgccgcgctgggttctgacattgtg
ctgccgtgcgacgttgctgaagatgagagcatcaccgcgctgttcaccgagctggaaaaa
gtctggccaaaattcgatggtttcgtccactcaatcggttttgccccggctgaccagtta
gacggcgactacgttgacgttgtcactcgcgacggctttaaaatcgcgcacgacatcagc
gcttacagcttcgtggcaatggccaaagcctgccgcggcatgctgaacccgggttcggct
ctgctgacgctctcctacctgggcgcagagcgcgcgatcccgaactataacgtgatgggt
ctggccaaagcctctctggaagctaacgtccgctatatggctaacgccatgggtccggaa
ggcgttcgcgtcaatgccatctctgccggtcctatccgtacgctggccgcgtccggtatt
aaagatttccgtaaaatgctggcgcactgcgaagcggtcaccccgatccgtcgcaccgtc
accattgaagatgtgggtaacagcgcagccttcctgtgctccaacctgtctgcggggatc
tccggtgaagtcgttcacgttgacggcgggttcaatatcgccgccatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system