KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_1568Help
Entry
VK055_1568        CDS       T03418                                 

Gene name
cydC
Definition
(GenBank) thiol reductant ABC exporter, CydC subunit
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VK055_1568 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpt02000]
    VK055_1568 (cydC)
Transporters [BR:kpt02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    VK055_1568 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N DUF87 AAA_16 NACHT MMR_HSR1 AAA_22 FtsK_SpoIIIE RsgA_GTPase AAA_29 AAA_23 AAA_25 AAA_30 AAA_5
Motif
Other DBs
NCBI-ProteinID: AIK80188
LinkDB All DBs
Position
1580236..1581957
Genome map
AA seq 573 aa AA seqDB search
MRALLPYLALYKRHKWMLLLGVVLAIVTLLASIGLLTLSGWFLSASAVVGVAGIYSFNYM
LPAAGVRGAAIIRTAGRYFERLVSHDATFRVLQHLRVFTFSKLLPLSPAGLARFRQGELL
NRVVADVDTLDHLYLRVISPLVGALVVIVVVTCGLSLLDVTLALTLGGIMLATLLVMPPL
FYRAGKPAGESMTQLRGQYRQQLTAWLQGQAELMVFNASDRYRAQMEKTELSWQDAQRRQ
AELTALSQAVMLLIGGIAVVAMLWLASDGVGGNSQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASARRISQITDQQPEVTFVEDEASPPAQVALTLREVTFRYPQQPSPALENIS
LQIAAGEHIAILGRTGCGKSTLLQLLTRAWDPSQGEILLNNQPLSGLSEATLRQAMSVVP
QRVHLFSATLRDNLLLAAPEADDAHLSATLEKVGLEKLLQDGGLNGWLGEGGRQLSGGEL
RRLAIARALLHDAPLMLLDEPTEGLDAATESQILHLLADVMRDKTVLMVTHRLRGLAGFN
QIIVMDNGQIIEQGSHADLLAKQGRYFQFKQRL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttttaccctatctggcgctctataagcgccataaatggatgctgctgctt
ggcgtcgtgctggccattgtgaccctgctggccagcatcggcctgctgacgctctccggc
tggttcctctccgcttcagcggtggtgggcgtcgccgggatctacagttttaactatatg
ctgcctgccgcgggcgttcgcggcgcggcaattatccgtaccgccgggcgctactttgag
cgcctggtcagccacgacgctacctttcgcgtgctgcagcacctgcgcgttttcaccttc
agcaaactgcttcccctctctccggcggggctggcgcgctttcgccagggtgagctgctc
aaccgggtggtagccgacgttgacaccctggatcatctctacctgcgggtcatttcgccg
ctggtcggcgcgctggtggtgattgtggtcgtcacctgcggattaagtctgctcgacgtc
accctcgcgctgacgctcggcggtatcatgctggcgaccctgctggttatgccgccgctg
ttctatcgcgcaggtaagccagccggcgaaagtatgacgcagctgcgcggccagtatcgc
caacagctcaccgcctggctgcagggtcaggcggagctgatggtatttaacgccagcgac
cgctaccgcgcacaaatggaaaagaccgagctgagctggcaggatgcacagcggcgccag
gccgagctgaccgcgctttcgcaggcggtaatgctgttaatcggtggcatcgccgtggtg
gccatgctctggctggcctcagacggcgtcggcggcaatagtcagcccggggcgctgatc
gcgctattcgtattctgcgcgctggcggcttttgaagccctggcgccggttactggcgct
ttccagcatttaggccaggtgatcgcctccgcgcggcggatctcgcagattaccgaccag
cagccggaggtcacctttgtcgaagatgaagccagtccgccagcgcaggtggccctaacg
cttcgggaggtcaccttccgctatcctcagcagccctcccctgccctggagaatatttcc
ctgcagattgccgccggagagcacatcgccattcttggccggaccggctgcggaaaatcg
acgctgttgcagttgcttacccgcgcctgggacccgtcacagggagagattctgctcaac
aatcagccgctctccggcctcagcgaagccactctgcggcaggcaatgagcgtagtgccg
cagcgcgtgcacctgttcagcgccaccctgcgcgacaacctgctgctggcggcgcctgaa
gcggatgacgctcatctcagcgctacccttgagaaggtgggcctcgaaaaactgctgcaa
gatggtggtcttaacggctggctgggcgaaggcgggcgtcagctctccggcggcgaactg
cgccgactggccattgcccgcgcgctgctccacgatgcgccgctgatgctgctcgatgaa
ccgacagaaggtctggatgcggccaccgaaagccagatcctgcatctgctggcagatgtc
atgcgcgacaaaaccgtgctgatggtgacccatcgcctgcggggcctggcgggttttaat
cagataatagtcatggacaacggccagataattgagcaaggtagtcacgcggatctgctc
gctaaacagggccggtacttccagtttaaacagcgtctgtag

DBGET integrated database retrieval system