KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_2442Help
Entry
VK055_2442        CDS       T03418                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00270  Cysteine and methionine metabolism
kpt00330  Arginine and proline metabolism
kpt00410  beta-Alanine metabolism
kpt00480  Glutathione metabolism
kpt01100  Metabolic pathways
Module
kpt_M00034  Methionine salvage pathway
kpt_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VK055_2442 (speE)
   00330 Arginine and proline metabolism
    VK055_2442 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VK055_2442 (speE)
   00480 Glutathione metabolism
    VK055_2442 (speE)
Enzymes [BR:kpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     VK055_2442 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 Methyltransf_31 MTS Methyltransf_12 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AIK81039
UniProt: A0A2X3GZ17
LinkDB All DBs
Position
2475854..2476714
Genome map
AA seq 286 aa AA seqDB search
MADNPLWHETLHDHFGQYFSVDNVLYHEKTDHQDLIIFDNRAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGNAKHVLIIGGGDGAMLREVSRHRSIETITMVEIDAGVVSFCRQY
LPNHNAGAYDDPRFTLVIDDGVNFVNQTTQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQDEAVGSHRKLSHYFRDVSFYQAAIPTYYGGIMTFAWASDNE
ALRHLSSEIIQARFHKANLTCRYYNPAIHTAAFALPQYLHDALSAP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtggccgataatccactgtggcatgaaacgctgcatgaccattttggtcagtattttagc
gttgataacgtgctgtaccacgaaaaaaccgatcatcaggatctgatcatctttgataac
cgcgcctttggccgggtgatggcgctggatggcgtcgtacaaaccaccgaacgcgacgag
ttcatctatcacgaaatgatgacccatgtgccgctgctggctcacggcaacgcgaagcat
gtgttaatcattggcggcggcgatggcgcgatgctgcgcgaagtctctcgtcaccgtagc
atcgaaaccatcaccatggtggaaatcgacgccggggtagtttcattctgccgccagtac
ctgccgaaccataacgccggcgcctatgacgatccgcgctttacgctggtgattgatgat
ggcgtcaattttgttaatcagacgacgcaaacgtttgacgtgatcatttcggactgtacc
gaccctatcggcccgggagaaagcctgttcacctcggctttttatgaaggctgcaaacgc
tgcctgaacccgggtgggatctttgttgcccagaatggcgtctgcttcctgcaacaggat
gaagcggtaggcagccatcgcaagctaagccactattttcgcgacgtcagcttctaccag
gcggcaattccaacctattacggcgggatcatgacctttgcctgggcgagcgacaatgag
gcgctgcgccatctctccagcgaaatcattcaggcgcgctttcacaaagccaacctgacc
tgccgttactacaatccggcaatccatacggcggccttcgccttaccacaatatctgcat
gatgctctgtccgcaccgtga

DBGET integrated database retrieval system