KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_2484Help
Entry
VK055_2484        CDS       T03418                                 

Gene name
ftsI2
Definition
(GenBank) essential cell division FtsI; penicillin-bindingprotein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00550  Peptidoglycan biosynthesis
kpt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VK055_2484 (ftsI2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VK055_2484 (ftsI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
    VK055_2484 (ftsI2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kpt03036]
    VK055_2484 (ftsI2)
Enzymes [BR:kpt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VK055_2484 (ftsI2)
Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   VK055_2484 (ftsI2)
Chromosome and associated proteins [BR:kpt03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    VK055_2484 (ftsI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AIK81081
UniProt: A0A2X3GW80
LinkDB All DBs
Position
complement(2523070..2524836)
Genome map
AA seq 588 aa AA seqDB search
MKAAPKTPKAKRQEEQANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVRQGDMR
SLRVQEVSTARGMITDRSGRPLAVSVPVKAIWADPKELHDAGGVTLDTRWKALADALNMP
LDQLATRINTNPRMRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNFAGTAKDTMRNRAIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESLVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASHPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgccaaaaacgcctaaagcaaaacgtcaggaagaacaggccaactttatc
agttggcgttttgcgttgctgtgcggctgtattctgctggcgctggcttttctgctgggt
cgcgtcgcctggctacaggtgatcagccccgatatgctggtgcgccagggcgatatgcgt
tctctgcgcgtacaggaagtgtccaccgcgcgcgggatgattaccgatcgctccggacgt
ccgctggcggtcagcgtgccggtgaaggctatctgggccgacccgaaagagctccatgac
gccggcggggttaccctggatacgcgctggaaagcgctggcggatgccctcaatatgccg
ctggatcagctggcgacgcgcatcaataccaatccgcggatgcggtttatctatctggcg
cgtcaggttaaccctgacatggccgattacatcaagaagctgaagctgccgggcattcat
ctgcgcgaagaatcccgtcggtactacccttccggggaagtaaccgctcacctcatcggc
tttaccaacgtcgatagccaggggattgaaggggttgaaaaaagctttgataaatggctt
accggtcagccgggcgagcgtatcgtgcgtaaagaccgctatggccgggtaattgaagac
atctcttctaccgatagccaggcagcgcacaacctggcgctgagtatcgacgaacgcctg
caggcgctggtttatcgcgagctaaacaacgccgtggcctttaacaaagccgagtcgggc
agcgccgtgttagtggatgttaacaccggtgaagtgctggcgatggccaacagcccatcc
tataacccgaacaacttcgccggtacggcaaaagacaccatgcgtaaccgtgcgattacc
gacgtgtttgagccgggttcgacggtgaaaccgatggtggtcatgacggcgctgcagcgc
ggtatcgtcaacgaaaataccgtgctcaataccgtgccttatcgaattaacggccacgaa
atcaaagacgtggcgcgctacagcgaattgaccctgaccggggtgctacagaagtcgagt
aacgtcggtgtttctaagctggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggcttggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttttctttcggctatggg
ctaatggtaaccccgttacagttagcgcgagtctacgcaacgattggcagctatggcatc
tatcgcccgttgtcgattaccaaagttgatcctccggttccgggcgagcgcgtcttcccg
gaatcactcgttcgtaccgtcgttcatatgatggaaagcgtggcgctgcccggcggcggc
ggtgtgaaagcggcgatcaaaggctatcgcatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggatggccgctatatcaacaaatatattgcttacaccgcaggcgttgcgccc
gccagccatccgcgcttcgcgctggtggtggtgatcaacgacccgcaggcaggtaaatac
tacggtggcgccgtttccgcgccggtcttcggtgccatcatgggcggcgtattgcgcacc
atgaacatcgagccggatgcgctggcaacgggcgaaaaaagtgaatttgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system