KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3004Help
Entry
VK055_3004        CDS       T03418                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VK055_3004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpt02000]
    VK055_3004
Enzymes [BR:kpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VK055_3004
Transporters [BR:kpt02000]
 Other Transporters
  Pores ion channels [TC:1]
   VK055_3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIK81589
UniProt: A0A1Y0Q9I4
LinkDB All DBs
Position
complement(3076664..3077332)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALKKIHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAARPWFAGERLSMADIQMSFPVM
ALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacatcatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggagaaaacgatgctggcgccg
gcggcgctgaaaaaaatccatccgttgggcaaatcaccggtactggaagacaacggctat
gtgctggcggagtccggggcgatcctcgagtatttgcaggaaacctgggacagcggcggg
ttgttgaagccgcagggaattgacgacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagccttggcaaaccc
cctgtgccctttggcgttcgctcgctgggttcgctgctgggcaaggggatacagaaaacg
tggctcgatccgcagctggccacccatgcgcggttcattgacgaccatcttgccgcacgg
ccatggttcgctggcgagcggctgagcatggctgatatccagatgagcttcccggtgatg
gcattgttggcgcgcggcggcatgcatgaccttgtccatatcgaggcctggcgtcagcga
gtggaacagcgaccggcctggcaacgcgccatcgagcgcggcggccccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system