KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3645Help
Entry
VK055_3645        CDS       T03418                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00250  Alanine, aspartate and glutamate metabolism
kpt00410  beta-Alanine metabolism
kpt00640  Propanoate metabolism
kpt00650  Butanoate metabolism
kpt01100  Metabolic pathways
kpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VK055_3645 (gabT2)
   00650 Butanoate metabolism
    VK055_3645 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VK055_3645 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VK055_3645 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpt01007]
    VK055_3645 (gabT2)
Enzymes [BR:kpt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     VK055_3645 (gabT2)
Amino acid related enzymes [BR:kpt01007]
 Aminotransferase (transaminase)
  Class III
   VK055_3645 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIK82200
LinkDB All DBs
Position
3762257..3763522
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDTQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggttgccgaccagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccggggctgattaccttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcaccctacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggcgtttaccccaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggatcaggtcgcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
caaaccggtttcgcccgtaccggcaagctgttcgccatgcagcattatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgtcgttggt
cgcgccgaagtgatggatgcgccagcgcctggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcagctgtgt
cagcgcgctgaacagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgtggatgtccgcggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgaaccgtcgccggaattcacccgccaggtgcaacagaaagcgcaggag
aacggcctgctgctactgagctgtggcgtctacggcaacgtgatccgattcctgtatccg
ttgactatcccggatacccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system