KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3704Help
Entry
VK055_3704        CDS       T03418                                 

Definition
(GenBank) peptidoglycan synthetase penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00550  Peptidoglycan biosynthesis
kpt01100  Metabolic pathways
kpt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VK055_3704
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VK055_3704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kpt01003]
    VK055_3704
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
    VK055_3704
Enzymes [BR:kpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VK055_3704
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VK055_3704
Glycosyltransferases [BR:kpt01003]
 Polysaccharide
  Bacterial polysaccharide
   VK055_3704
Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VK055_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AIK82259
LinkDB All DBs
Position
complement(3831463..3833898)
Genome map
AA seq 811 aa AA seqDB search
MRLQIPMQVYSADGELIAQYGEKRRIPVTLQQIPPELVKAFIATEDSRFYEHHGVDPVGI
FRAASVAMFSGHASQGASTITQQLARNFFLSPEKTLMRKIKEAFLAIRIEQLLNKDEILE
LYLNKIYLGYRAYGVGAAAQVYFGKPIDQLTLSEMAVIAGLPKAPSTFNPLYSMDRATAR
RNVVLSRMLSEGYITQAQYDEARSEPIDASYHAPKIAFSAPYLSEMVRQEMVNRYGEQAY
EDGYRVYTTITRKNQQAAQQAVRNNVLDYDMRHGYRGPASVLWKVGETPWETKKIVDSLK
RQSGYGPLFPAVVTSANAQEAVALLANGDSVSLTMEGVRWARRFISDTQQGATPRKVNDV
VQAGQQIWVRKVGDSWWLSQLPDVNSALVSINPQNGAIIALVGGFDFNQSKFNRATQALR
QVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDAGAGSDWRPKNSPPQYAGPIRLRQGL
GQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHTESLALGSASFTPLQVARGYSVMA
NGGFLVNPFFISKIENDQGGVLFEERPKIACPQCDLPVIYGDTPKSNVLENKDVEDVATS
AEPQNGNVPPQPQLEQANQSLVAQSGAQEYAPHVINTPLAFLIKSALNSNIFGEPGWMGT
GWRAGRDLQRHDIGGKTGTTNSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIK
DQISGYEGGAKSAQPAWDSFMKSVLEGVPEEPLTPPPGIVTVNIDRSTGQLANGGNSRAE
YFIEGTQPTQQAVREVGTTLTDGGGETHELF
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttgcagatcccgatgcaggtctatagcgccgacggtgagcttattgcgcagtac
ggcgaaaagcgccgtatccctgtgacgttgcagcaaattccccccgagctggtgaaagcg
tttatcgccaccgaagacagccgcttctatgagcaccacggcgtcgatccggtaggtatt
ttccgcgccgccagcgtggcgatgttttcaggccacgcctcccagggcgccagcaccatc
acccagcagttagcgcgtaacttctttctcagccccgagaagacgttgatgcgtaagatt
aaagaggcctttctggccatccgcatcgagcagttgctgaataaagatgaaatccttgag
ctgtatctgaacaagatctacctcggctaccgcgcctatggcgtcggcgccgcggcgcag
gtctattttggtaaacctatcgaccagctgaccctgagtgagatggcggtgattgccggt
ctgccgaaagcgccttccacttttaacccgctctattcgatggatcgcgcgaccgcccgt
cgcaacgtggtgctgtcgcgtatgctgagcgaagggtacatcacccaggcacaatacgat
gaggcgcgcagcgaacccatcgacgccagctatcacgcgccgaaaatcgccttctccgcc
ccttacctgagtgaaatggtgcgccaggagatggtgaatcgctacggcgagcaggcctac
gaagacggttatcgggtctacaccaccattacccgtaaaaaccagcaggcggcccagcag
gcggtacgcaataacgtgctggattacgatatgcgtcacggctaccgcggcccggccagc
gtactgtggaaagtcggcgaaacgccgtgggagacgaagaagatcgtcgattcgctgaag
cgtcagtctggctacggtccgcttttcccggcggtggtcacctccgcgaatgcccaggag
gctgtcgcgctgttggctaacggcgactccgtttcgctgacgatggagggcgtgcgctgg
gcccgtcgctttatctctgatacgcagcaaggggcgaccccgcgtaaagtcaacgacgtt
gtgcaggccgggcagcagatctgggtacgcaaggtgggtgacagctggtggctgtcccag
ctcccggacgtcaattcagcgctggtctccattaacccgcaaaacggcgcgattattgcc
cttgtcggcggatttgactttaaccagagcaaattcaaccgcgccacccaggcgctgcgc
caggtcggctccaacattaaaccgttcctctataccgccgcgatggataaaggcttaacg
ctggcaagtatgctcaacgatgtgccgatctcgcgctgggatgcgggcgcaggttccgac
tggcggccgaagaactcgccgccgcagtatgccggtccgattcgtttacgccagggcctg
gggcagtcgaaaaacgtggtgatggtgcgcgctatgcgcgccatgggcgtagactacgcc
gccgagtatctgcagcgctttggcttcccggcgcagaacattgtccacacggaatcgttg
gcgctgggctcggcctcctttacgcccctgcaggtcgctcgcggttattcggtgatggcc
aacggcggcttcctggtcaatcctttctttatcagtaagattgagaacgatcagggcggg
gtcctctttgaggagcgtccgaaaattgcctgtccgcagtgtgatttaccggtaatttac
ggcgatacgccaaaatccaacgtgctggaaaacaaggatgtggaagatgtcgccacctcc
gcggaaccgcagaatggcaacgtgccgccgcagccgcagctggagcaggccaaccagtcg
ctggtcgcgcagagcggcgcgcaggaatacgcgccgcatgtgattaacacaccgctggcc
ttcctgatcaagagcgcgctgaacagcaacatctttggcgagccgggctggatgggcacc
ggctggcgcgccggacgcgatctgcagcggcatgacatcggtgggaaaaccgggaccacc
aacagctcgaaggacgcctggttctcaggctacggaccgggcgtggtgacctcggtttgg
atcggctttgacgatcatcgtcgcgatcttggccggaccaccgcctccggagcgattaaa
gatcagatctctggctatgaaggcggtgccaaaagcgcccagccggcctgggacagcttt
atgaagagcgtgctggaaggcgttccggaagaaccgttaactccgccgccgggtatcgtc
acggtgaatatcgaccgcagcaccggtcagttggcgaacgggggcaatagccgggcggag
tactttattgaaggaacccagcccacccagcaggcagtccgtgaggtgggcaccaccctg
actgacggcggcggtgaaacccacgaattgttctga

DBGET integrated database retrieval system