KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3709Help
Entry
VK055_3709        CDS       T03418                                 

Definition
(GenBank) shikimate kinase family protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpt01100  Metabolic pathways
kpt01110  Biosynthesis of secondary metabolites
kpt01130  Biosynthesis of antibiotics
kpt01230  Biosynthesis of amino acids
Module
kpt_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VK055_3709
Enzymes [BR:kpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VK055_3709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE ABC_tran APS_kinase AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_2 AAA_28 His_biosynth AAA_29 RsgA_GTPase PduV-EutP AAA_24 Mg_chelatase MMR_HSR1 GTP_EFTU IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AIK82264
UniProt: A0A1Y0PUK7
LinkDB All DBs
Position
3837696..3838217
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDAPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttagcccaacagctcaacatggaattttacgattctgatcaagagattgag
aaacgcactggcgctgatgtgggctgggtcttcgatgttgaaggcgaagaaggcttccgt
gaccgtgaagagaaaattatcaatgagttgacggaaaaacaggggattgtgctggcgact
ggcggcggctctgtaaaatcccgtgaaacgcgtaaccgtctctccgcccgcggcgtggtg
gtctacctggaaactacgatcgagaagcagttggcccgtacgcagcgcgataaaaagcgt
cctttgctacaagtcgatgcgccgcctcgtgaagtgctggaagcgctggctgacgagcgt
aacccgctgtatgaagagatcgccgatgtgactatccgcacagacgatcagagtgcgaaa
gtcgtcgcgaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system