KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3885Help
Entry
VK055_3885        CDS       T03418                                 

Gene name
dacB
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VK055_3885 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kpt01002]
    VK055_3885 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
    VK055_3885 (dacB)
Enzymes [BR:kpt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VK055_3885 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     VK055_3885 (dacB)
Peptidases and inhibitors [BR:kpt01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   VK055_3885 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:kpt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VK055_3885 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase TrbL
Motif
Other DBs
NCBI-ProteinID: AIK82435
LinkDB All DBs
Position
complement(3989866..3991272)
Genome map
AA seq 468 aa AA seqDB search
MTAGIALSAQAANIDEYINQLPAGANLAFMAQKVGASTPEIDYHSQQMALPASTQKVITA
LAALLQLGPDFRFTTTLETKGSLDGGVLKGDLIARFGGDPTLKRQDIRNMVATLKKAGVQ
RIEGNVLIDTSVFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSVSLYSAQKPGDVAF
IRVASYYPVTMFSQVRTLARGSSEAQYCELDVVPGDLNRYTLTGCLPQRSEPLPLAFAIQ
DGASYAGAILKAELAQAGITYSGTLLRQTLANEPGTVLATSQSAPLHDLLRIMLKKSDNM
IADTVFRTIGHARFGVPGTWRAGSDAVRQILRQQAGVDLGNTIIADGSGLSRHNLIAPAT
MMQVLQYIAQHDTELNFISMLPLAGHDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAG
FITTASGQKVAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDLYQNN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccggtatagcgcttagcgctcaggcggcgaatattgacgagtacatcaaccag
cttcccgccggtgcgaaccttgcctttatggcgcaaaaggtcggcgcatcgacgccggaa
atcgactatcacagccagcaaatggcgctcccggccagtacgcaaaaggtcatcaccgcg
ctggcggcgctgctgcaactggggcccgattttcgctttaccaccacgctggaaaccaaa
ggttcccttgacggcggcgtgctgaaaggcgacctgattgcgcgcttcggcggcgatccg
acgcttaaacggcaggatattcgcaatatggtggcaacgctgaaaaaagccggcgtgcag
cgtatcgaaggcaatgtgctcatcgatacgtcggtcttcgccagccatgacaaagcgccc
ggctggccgtggaacgacctgacgcagtgcttcagcgccccgccggcggcggcgattgtc
gaccgtaactgcttctctgtctcgctgtatagcgcgcagaaaccgggcgatgtcgccttc
attcgcgttgcatcctattatccggtcaccatgttcagccaggtgcgaacgctggcgcgt
ggctcatcggaagcgcagtattgcgagctcgacgtggtgccgggcgatctcaatcgctat
actctcaccggctgcctgccgcagcgtagcgagccgctgcctctggccttcgccattcag
gatggcgccagctatgccggagcaatcctcaaagccgagctagcccaggcggggatcacc
tacagcggcacgctgctgcgccagacgctggccaatgagcccggcaccgtgctggcaacc
agccagtcggctccgctgcacgatctgctgcggatcatgctgaagaagtcagacaacatg
attgccgacaccgtctttcgcaccatcggccacgcccggttcggcgtacctggcacctgg
cgggcgggctccgatgccgtacggcagatcctgcgtcaacaggctggggtcgatctcggc
aacactatcatcgccgacggctctggcctgtcgcgccacaacctgatcgccccggcgacc
atgatgcaggtgctgcagtatatcgcccagcacgataccgagctcaacttcatctccatg
ctgccgctggcgggccatgacggatcgctgcagtatcgcgccggtcttcatcaggcgggc
gtcgatggtaaagtttcggcgaaaaccgggtcgctccagggggtttataacctcgcaggc
ttcatcactaccgccagcggacaaaaggtggccttcgtgcaatatctctccggatacgcc
gtggagccagctgatcagcgcaatcgccgcatcccactggtccgctttgaaagccgcttg
tataaagatttgtaccagaacaattaa

DBGET integrated database retrieval system