KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0464Help
Entry
KP1_0464          CDS       T00910                                 

Gene name
sgaU
Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00040  Pentose and glucuronate interconversions
kpu00053  Ascorbate and aldarate metabolism
kpu01100  Metabolic pathways
kpu01120  Microbial metabolism in diverse environments
Module
kpu_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KP1_0464 (sgaU)
   00053 Ascorbate and aldarate metabolism
    KP1_0464 (sgaU)
Enzymes [BR:kpu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     KP1_0464 (sgaU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM HTH_Tnp_1 DPRP ComA
Motif
Other DBs
NCBI-ProteinID: BAH61343
LinkDB All DBs
Position
464755..465609
Genome map
AA seq 284 aa AA seqDB search
MLAKSIPLGIYEKALPAGECWLERLKLAKALGFDFVEMSLDETDARLARLDWSPEQRLAL
VKAVAETGVRVPSMCLSAHRRFPLGSEDDAVRHQGLEIMRKAIQLAQDVGIRVIQLAGYD
VYYQQANDETRRRFRDGLKQSVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWF
QLYPDIGNLSAWDNDVQMELKAGSGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLK
QTGYCGPYLIEMWSETSADPLAEVAKARDWVKARMARAGLMEAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaaatccattccgctcggcatctatgaaaaagcgctccccgccggggagtgc
tggctggagcggctaaagcttgcaaaagcgctgggctttgatttcgttgagatgtctctc
gatgaaacggacgcccgccttgcgcggctggactggagcccggagcagcgtctggcgctg
gtcaaggcggtggctgaaaccggcgtccgggtgccgtcgatgtgccttagcgcccatcgc
cgttttccgctgggtagcgaagacgacgcggtgcggcatcaggggctggaaattatgcga
aaagctattcagctggcgcaggatgtggggattcgggtgatccagctggcaggctacgac
gtctattaccagcaggcgaacgatgagacgcgccgccgctttcgtgacggcctgaaacag
agcgtcgagatggccagccgagcccaggtaaccctggcgatggagatcatggactacccg
ctgatgaactcgatcagtaaagcgctgggctatgcccattacctgaataatccgtggttc
cagctttacccggatatcggcaatctgtcggcgtgggataacgacgtccagatggagctg
aaggcggggagcgggcatatcgtggcggtacacgtcaaagacacaaagcccggcgtcttt
aaaaacgtgccgttcggcgaaggggtggtcgattttgaacgctgcttcgaaacgctcaag
cagaccggctactgcggaccgtacctgattgagatgtggagcgaaaccagcgctgacccg
ctggcggaggtggcgaaggcgcgtgactgggtgaaggcgcggatggcccgcgcgggcctg
atggaggcggcataa

DBGET integrated database retrieval system