KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_1117Help
Entry
KP1_1117          CDS       T00910                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00010  Glycolysis / Gluconeogenesis
kpu00020  Citrate cycle (TCA cycle)
kpu00620  Pyruvate metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
Module
kpu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_1117 (acoC)
   00020 Citrate cycle (TCA cycle)
    KP1_1117 (acoC)
   00620 Pyruvate metabolism
    KP1_1117 (acoC)
Enzymes [BR:kpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KP1_1117 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-ProteinID: BAH61914
LinkDB All DBs
Position
complement(1089708..1091243)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDSFTPGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDEFAASLATVKPAAPGPEAAAPDVAAQAGAKP
ASVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEQPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLALRQDINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcggtgggcaatccaggagggtgacagcttcaccccagggcaggaaatctgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggccccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgaatttgctgccagcctggcgacggtgaaaccc
gcagccccaggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
gcttccgttgtttccccgccatccaacagccccgagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggcgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtatctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgcctcccgttcgtcgcagcaaagcgccccgctcgcatgccgatgatagccaggta
tcggccaccccgctggcgcgccgtctggccggcaaactgggtatcaacttacatgactgc
cgaagcagcggttcacgcggtcgggtgagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcaaccgcagaccagccctgtgcaggagagtgccccggcaccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgagcgtcgatctcgatctggagcgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgtcaagatttcggtgaatgacctgctggtgaaggcc
tgcgccctggcgctggtggccgtgcctgacgtcaatatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgatcagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgccagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system