KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_1186Help
Entry
KP1_1186          CDS       T00910                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00730  Thiamine metabolism
kpu00790  Folate biosynthesis
kpu01100  Metabolic pathways
kpu02020  Two-component system
Module
kpu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KP1_1186 (phoA)
   00790 Folate biosynthesis
    KP1_1186 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KP1_1186 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpu04147]
    KP1_1186 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpu00537]
    KP1_1186 (phoA)
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KP1_1186 (phoA)
Exosome [BR:kpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KP1_1186 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpu00537]
 Enzymes
  KP1_1186 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: BAH61976
LinkDB All DBs
Position
1151750..1153204
Genome map
AA seq 484 aa AA seqDB search
MFFLSIFYMEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRL
TGDQTEALRASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYT
HYSLDKKTGKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGN
VSTAELQDATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLG
GGAKTFTETATAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMP
VRWEGPKASYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGAS
IDKQDHAANPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPG
LTQALNTHDGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAA
LSLK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgttttttttaagtattttttacatggagatgacaaaagtgaaattaagcgctctgttt
attgccctgattcctctactgggctcgccggttattcatgcagaaactactgctgcgccg
gttctggaaaatcgcgctgcgcagggagatatcaccactcctggcggcgcgcgtcgttta
acaggcgatcaaaccgaagcgctgcgcgcctcgttaatcaataagccagctaaaaacgtt
attttgctgattggcgatggcatgggtgattcggaaattaccgctgcgcgaaactatgcc
gagggggcgggcggtttctttaaaggaattgatgctctgccgttaaccgggcagtacacg
cattattcgctggataaaaaaaccgggaaaccggactacgtgaccgactcggcggcctcc
gccaccgcctggaccaccggcgtgaagacttataacggcgcgctgggcgtcgatattcat
gagaatgcgcatcagaccatcctcgagctggcgaaagcggcggggctggccaccggcaac
gtttccaccgccgagctgcaggacgccacccccgcggcgttggtagcgcatgtgacatcg
cgtaaatgctacggcccgacggtcaccagcgaaaaatgccccagcaatgcgctggaaaaa
gggggcaaaggctccattaccgaacagctgctgaacgcccgaccggatgtcaccttgggc
ggcggcgcgaagacctttaccgaaacggcgacggcgggcgagtggcagggcaaaaccctg
cgcgagcaggcgcaagcgcgcggctaccagattgtgaccgacgcggcttctcttgccgcc
gcgacggaagccagtcaggataaaccgctgctgggactctttgccgatggcaatatgccg
gtacgctgggaagggccgaaggcgtcttatcacggtaatatcgataagccgccggtgacc
tgtacgccaaacccgaagcgtgacgcctcggtgccgacgctggcgcagatgacggagaaa
gcgattgacctgctcagtcgcaacgagaaaggtttcttcctgcaagtcgaaggcgcttcc
atcgataagcaggaccatgcggcgaatccgtgcggccagatcggcgaaacggttgatctt
gacgaagcggtgcagaaggcgctggaattcgcgcgaaaagacggtaataccctggtgatc
gtcaccgccgaccatgcgcatgccagccagatcatcccggcggatagcaaagccccgggg
ctgacccaggctctgaacacgcacgatggcgcggtgatggtgatgagctacggcaactct
gaggaagagtcgatggagcacaccggcacccaactgcgcattgcggcctacggtccgcat
gcggctaacgtcgtaggcctgaccgatcagaccgacctgttcacgaccatgaaagctgcc
ctgagtctcaaataa

DBGET integrated database retrieval system