KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_2123Help
Entry
KP1_2123          CDS       T00910                                 

Gene name
tktA
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00030  Pentose phosphate pathway
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
kpu01230  Biosynthesis of amino acids
Module
kpu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KP1_2123 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    KP1_2123 (tktA)
Enzymes [BR:kpu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     KP1_2123 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAH62831
LinkDB All DBs
Position
2065422..2067428
Genome map
AA seq 668 aa AA seqDB search
MKTTNTTRRQCANALRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPNNPAWAD
RDRFVLSNGHGSMLIYSLLHLTGYDLPISELKNFRQLHSKTPGHPEVGYTAGVETTTGPL
GQGIANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLG
KLVAFYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKRAVEEARAVTD
KPSLLMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREALGWKHAPFDIPSDIYAQWDA
KEAGQAKEAAWNEKFAAYAKAFPQEAAEFTRRMKGEMPSDFDAKANEFIAKLQANPAKIA
SRKASQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKPINEDAAGNYIHYGVREFGMTA
IANGIALHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPV
EQVASLRVTPNMSTWRPCDQVESAIAWKYGVERQDGPTALILSRQNLAQQERTAEQLANV
ARGGYVLKECTGSQPELIFIATGSEVELAVAAWDKLTAEGVKARVVSMPSTDAFDKQDAA
YRESVLPKAVTARVAVEAGIADYWFKYVGLNGAIVGMTTFGESAPAEQLFEEYGFTVDNV
VAKAKALL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacaaataccactcgccgccaatgcgccaacgcgctgcgcgccctgagcatg
gacgctgtacagaaagccaaatccggccacccgggggccccgatgggtatggctgacatt
gccgaagtgctgtggcgtgatttcctgaaccataacccgaacaatccggcctgggctgac
cgtgaccgttttgtgttgtcaaatggccatggttcgatgctgatttacagcctgctgcac
ctcactggctacgatctgccgatatccgagctgaaaaacttccgccagctgcactccaaa
accccgggtcacccggaagtcggctacaccgcaggcgtggaaaccaccaccggtccgctg
ggccagggtatcgctaacgcggtcgggatggctatcgccgagaaaaccctggcggcgcag
ttcaaccgtccgggacacgatatcgtcgaccactacacctacgccttcatgggcgacggc
tgcatgatggaaggcatttctcacgaagtgtgctccctggccggtaccctgaaactgggt
aaactggtggcgttctatgatgacaacggcatctccatcgacggccacgttgaaggctgg
ttcaccgacgacaccgccaaacgctttgaagcctacggctggcacgtggtgcgcggcgtg
gacggtcacgacgctgacgccatcaaacgcgcggtagaagaagcgcgggcggtcaccgac
aaaccgtccctgctgatgtgcaaaaccatcatcggtttcggttcgccgaacaaagccggc
acccacgactcccacggcgcgccgctcggcgacgccgaaatcgccctgacccgcgaagcg
ctgggctggaaacacgcgccgtttgacatcccgtctgacatctatgcccagtgggatgcc
aaagaagccggccaggcgaaagaagcggcgtggaatgagaagttcgctgcctacgccaaa
gccttcccgcaggaagcagccgaattcacccgccgtatgaaaggcgagatgccgtctgac
ttcgatgcgaaagctaacgagttcatcgcgaagctgcaggccaacccggcgaaaatcgcc
agccgtaaagcctcgcagaacgccatcgaagccttcggcccgctgctgccggaattcctc
ggcggctccgcagatctcgcgccgtccaacctgaccctgtggtccggttctaagccgatc
aacgaagacgctgccgggaactacatccactacggcgtgcgcgagttcggtatgaccgct
atcgccaacggtatcgcgctgcacggcggcttcctgccgtacacctccaccttcctgatg
ttcgtggaatacgcgcgtaacgcggtacgtatggccgcgctgatgaaacagcgtcaggtg
atggtctacacccacgactcgatcggtctgggcgaagacggcccgactcaccagccggta
gagcaggtggcttccctgcgcgtgaccccgaacatgtccacctggcgtccgtgtgaccag
gtggaatccgcgattgcgtggaaatatggcgtggagcgtcaggacggcccgaccgcgctg
atcctctcccgtcagaacctggcgcagcaggagcgtaccgcagagcagctggcgaacgtg
gcccgcggcggttatgtgctgaaagagtgcaccggctcgcagccggagctgatcttcatc
gccaccggttcagaagtggagctggcggttgccgcgtgggacaaactgactgccgaaggc
gtgaaggcgcgcgtggtttccatgccgtccaccgacgcgttcgacaagcaggatgcggct
tatcgcgaatccgtactgccgaaagccgtgaccgcgcgcgttgccgtggaagcgggtatc
gctgactactggttcaaatacgttggcctgaacggcgctatcgttggcatgaccaccttc
ggtgagtctgcgccggctgagcagctgttcgaggagtacggcttcaccgtcgataacgtg
gttgctaaagcgaaagcactgctgtaa

DBGET integrated database retrieval system