KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_2385
Entry
KP1_2385          CDS       T00910                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K04749  anti-sigma B factor antagonist
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:kpu03021]
    KP1_2385
Transcription machinery [BR:kpu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     KP1_2385
SSDB
Motif
Pfam: STAS STAS_2
Other DBs
NCBI-ProteinID: BAH63069
LinkDB
Position
2292537..2292896
AA seq 119 aa
MNVQGTVMKIETERQASVTILTPAVRRLDASVAVAFKAAIAQEIGEDSTDLIVDFSKIDF
IDSSGLGTLVSLMKMMNGKGEMTLCALNPGIRNMFTLTRMDRIFRICEDRTSALAQFNP
NT seq 360 nt   +upstreamnt  +downstreamnt
ttgaacgtacaggggacagtgatgaaaattgaaactgaacggcaggcctcggtgacgatc
ctgacgccggcggtgcgtcggctggatgcttccgtcgcggtagcctttaaggcggcaatc
gcccaggagataggcgaagatagcactgatctgattgttgatttcagtaaaatcgatttt
atcgacagcagcggtttgggaacgctggtttccctgatgaaaatgatgaacggtaaagga
gaaatgacactgtgcgcgctgaaccccggcattcgcaatatgtttaccctgaccaggatg
gatcgtatttttcgtatttgcgaggatcgcacttcagcccttgcgcagttcaatccgtga

DBGET integrated database retrieval system