KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_4855
Entry
KP1_4855          CDS       T00910                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00052  Galactose metabolism
kpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KP1_4855 (gatD)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     KP1_4855 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C Methyltransf_31 MTS UDPG_MGDP_dh_N 3HCDH_N ELFV_dehydrog Methyltransf_24 PrmA CoA_binding Pyr_redox_2 Methyltransf_11 Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: BAH65328
LinkDB
Position
4629462..4630505
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATHVFNSREMSGQAIQQALEAIQFDQLVLETAGTP
QTVALAIEAAGPRAQLTLVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFARAVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatcccc
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccgggttatgcggctcc
gatatcccgcgcattttcgccaaaggggcgcattactaccctattacgctggggcacgaa
ttcagcggttatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccttgcttccagtgcccgcaatgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgatggc
gcgtttatagaaccgataaccgttggcctgcacgcttttcatctggcgcagggctgtgaa
ggtaaaaacgtgattattatcggcgccggcaccatcggcctgctggcgctacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaagctggagctg
gccaaaacccttggcgcaacccatgtgttcaacagtcgcgagatgagcggccaggcgatt
cagcaggcgctggaagccattcagttcgatcagttagtcctcgagaccgccggtacgccg
cagaccgtcgcgctggcgattgaggccgccggtccgcgggcgcagctgacgctggttggc
acgcttcatcatgatttaaccctcccggcagccaccttcgggcagattctgcgtaaggag
ttgaatattgtgggtagctggatgaactactctggcccgtggccgggagaagagtggcaa
acggccacccgtctgctgactgaaaaacgcctgcagctggcgccgctgatcgcccatcgt
ggcgacgcagaaagcttcgctcgtgcagtgcaggcgctcaacggcgcgccaatgcaaggc
aaaatcctgctcaaactctcttga

DBGET integrated database retrieval system