KEGG   Kroppenstedtia pulmonis: GXN76_02735
Entry
GXN76_02735       CDS       T06617                                 

Gene name
pcrA
Definition
(GenBank) DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
kpul  Kroppenstedtia pulmonis
Pathway
kpul03420  Nucleotide excision repair
kpul03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:kpul00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    GXN76_02735 (pcrA)
   03430 Mismatch repair
    GXN76_02735 (pcrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kpul03400]
    GXN76_02735 (pcrA)
Enzymes [BR:kpul01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GXN76_02735 (pcrA)
DNA repair and recombination proteins [BR:kpul03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     GXN76_02735 (pcrA)
   MMR (mismatch excision repair)
    Other MMR factors
     GXN76_02735 (pcrA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 Exonuc_V_gamma ResIII
Other DBs
NCBI-ProteinID: QKG83492
LinkDB
Position
558577..560769
AA seq 730 aa
MAHDSWTKDDLLKGLNPDQRQAVETTEGPLLIVAGAGSGKTRVLTNRVAYLLGEKRIHPW
NILAITFTNKAAKEMKERIQHLVGPSAEDIWISTFHSMCVRMLRRDIDRIGFSRNFTILD
SSDQLTVIKQVLKEQNIDPKQFPPRSFLNRISNAKNQLLSPGDMEERASGFREEQAARVY
RSYQEKLRINQSLDFDDLLVETVRLFQQVPEVLDYHQRKFQYIHVDEYQDTNHVQYILVK
MLAAKHRNLCVVGDSDQSIYRFRGADITNILHFERDYLDAAVIKLEQNYRSTKTILDAAN
EVIAHNQGRKPKNLWTENEQGDCVQYFEAENEHDEAYFVADKIVNGRKKGQDYRDFAILY
RTNAQSRVFEDVLIKSNIPYQMVGGTKFYERKEIKDLLAYLRLVVNPDDDLSLSRVINVP
RRGIGQATLDKIIHYAQTQDLSLFKALLEAENIGLTPRFLKPLKSFVNLIRECHAMMEYL
TAGELTEEILQRTGYREELKKEETVEAASRLENIDEFLSVTKEFEDKNEDKTLVAFLTDL
ALVSDVDALDEEGTTTSAITMMTLHSAKGLEFPQVFLVGMEEGIFPHSRTLDDPEEMEEE
RRLAYVGITRAQSNLFLTRSRYRMLFGQTSANPPSTFLKEIPEHLLEPVGQPSSSGTTVK
AYSRKGPVRPAQNTDLDWRVGDRVQHKKWGLGTVVKVQGEKDDTELNIAFPSPVGVKRLL
ARFAPITRAD
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggcacatgattcttggacaaaggatgatctgttgaaggggttaaatccggatcagcgt
caagcggtggaaacaacggagggacccctgttgattgtggcgggagcaggaagcggcaag
acccgggttttaacgaatcgagtggcttatcttttgggagagaaacggattcatccgtgg
aatatcctggccatcacctttaccaacaaagcggccaaggagatgaaagaacggattcaa
cacctggtggggccctcagcggaagatatctggatctccaccttccactcgatgtgtgtc
cgtatgctgcggcgggacatcgatcggatcggtttttcccgaaactttaccattctggac
agctcggatcagctgacagtgatcaagcaggtgctgaaagaacagaatatcgatcccaaa
caatttcccccccggtcttttttgaaccggatcagcaatgccaaaaaccagctgctttca
cctggggacatggaggagcgggcatcaggattcagggaagaacaggcggccagggtgtac
cgatcctatcaggaaaaactgcggatcaaccagtccctggattttgatgacttgcttgtg
gaaacggtacggctgttccaacaggtaccggaagtactggattatcatcagcggaagttt
cagtatatccatgtggatgaataccaggatacgaaccatgtccaatatatcctggtaaaa
atgctggcggcaaagcaccgcaatttgtgtgtggtaggtgattcagatcagtccatctat
cgctttcggggagcagatatcaccaatatccttcactttgagcgggattatcttgatgct
gctgtgattaaactggagcaaaactatcgttccaccaagaccattttggatgccgccaat
gaagtgattgctcataatcagggacggaaaccgaaaaatctgtggactgagaatgaacaa
ggggattgtgtacagtattttgaagcagagaatgaacatgatgaagcttattttgtagcg
gacaagattgttaacggacgaaaaaagggacaagattaccgggactttgccatcctgtac
cgaaccaatgcccagtcccgggtgtttgaggatgttctgatcaagtccaatattccctat
caaatggtaggcggcactaagttttatgaacggaaagaaatcaaggatctactggcttat
ttgcgtctggtggtcaatccggatgatgacttgagtttgtccagggtgatcaatgttcca
cgtcggggaatcggacaagccaccttggataagattatccattatgcccaaacgcaagat
ctctctttgttcaaagcgctgttggaagcggagaacatcggattgactccccgttttctc
aagcctttgaaatcctttgtcaacttaatcagggaatgccatgcaatgatggagtatctg
acggcgggagagctgactgaagagattttgcaacgtacaggctaccgggaggaactgaaa
aaggaagaaacagtggaagcggccagccgcttggaaaatattgatgaatttctgtctgta
accaaggaatttgaagataaaaatgaggataaaaccctggtggcctttttgacggatctg
gccctggtgtccgatgtggatgctctggatgaagaaggaacgacgacaagtgccattacg
atgatgacccttcacagcgccaaaggactggaatttccccaggtttttttggtgggaatg
gaagaagggattttcccccatagtcgcacattggatgatccggaagaaatggaggaagaa
cggagactggcctatgtggggattacccgggcacagagtaatctgtttttgacccgatcc
cgttatcggatgctgtttggacagaccagtgccaaccccccgtccacatttctcaaggaa
attccggaacatctgctggaacctgtaggtcaaccctccagctctggaacgacggtaaaa
gcctattcccgcaaaggtcctgtccgacctgcccagaataccgatttggattggcgggtt
ggcgatcgggtacaacataaaaagtggggattgggaacggtggtcaaggtacaaggggaa
aaggatgatacggaattaaacattgcctttccgtctcctgtgggagtaaaacgtcttttg
gccaggtttgcccctatcacccgggcagactaa

DBGET integrated database retrieval system