KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_00475Help
Entry
KPNIH29_00475     CDS       T03465                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00620  Pyruvate metabolism
kpv00680  Methane metabolism
kpv01100  Metabolic pathways
kpv01120  Microbial metabolism in diverse environments
kpv01200  Carbon metabolism
Module
kpv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kpv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH29_00475
  Energy metabolism
   00680 Methane metabolism
    KPNIH29_00475
Enzymes [BR:kpv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KPNIH29_00475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIX67132
UniProt: A0A1Y0Q638
LinkDB All DBs
Position
complement(99741..102392)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISANGEAASNPEVIARTLRKLKDQPNLNEE
TIKQAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRSQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGSELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtcaaacgacgaactgctgccggtggcccgtgccttcagccagtttctgaat
ctggccaacaccgctgagcagtaccacagcatttcggccaatggcgaagcggccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaatgaagag
accatcaaacaagcggtggaatcgctgtctctggagctggtgttaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaagtgaacaactgccttaagcag
ttggacaacaaagatatcgctgactacgagcaccatcagctaatgcgccgtctgcgccag
ctgatcgcccagtcgtggcataccgatgaaattcgtaagcaccgcccttccccggtcgat
gaagccaaatggggtttcgcggtggtggaaaacagcctgtgggaaggggtgcctaactat
ctgcgcgagctgaacgaacagctggaagccaaccttggctatcagctgccggtggacttc
gtcccggtgcgtttcacctcgtggatgggcggcgaccgcgacggcaacccgaacgtgact
gccgacatcacccgccacgtgctgctgctcagccgctggaaagcgaccgacctgttcctc
aaagacgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgagctgcgc
gccctggctggcgccgagggcgctcaggaaccttaccgttatctgatgaaaaaactgcgc
tctcagctgatggagacccaggcctggctggaagcgcgcctgaaaggccagaagctgccg
aaaccggcgggactgatcactcagaacgagcagctgtgggagccgctgtacgcctgctat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgagctgctcgacaccctg
cgccgcgtgaagtctttcggcgtaccgctggtgcgtattgatattcgtcaggaaagcacc
cgccataccgaagcgctgggtgaaatgacccgttacctcgggatcggcgactacgaaagc
tggtcggaagccgacaaacaggctttcctgatccgcgaactgaattccaaacgtccgctg
ctgccgcgccagtgggagccaagcgaagagacgcgtgaagttctcgacacctgcaaggtg
atcgccgaggcgccgcgcggatcgatcgccgcctacgtgatctcgatggcgaaaacgccg
tccgatgtgctggcggttcatctcctgctgaaagaagccgggattggctttgctctgccg
gtggccccgctgttcgaaacgctggatgacctcaacaacgccaacgacgtcatgacccag
ctgctgaatatcgactggtaccgcggctttatccagggcaagcagatggtcatgatcggc
tactctgactccgctaaagatgccggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgaaaaagccggtattgaactgacgctgttccacggt
cgcggcggctctatcggccgcggcggcgcgccggcccacgccgcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtataccagcgccattctggaa
gccaacctgctgccgccgccggagccgaaagcagaatggcgcgacatcatggccgagctg
tccgacgtgtcgtgcaagatgtatcgcggctacgtgcgtgaaaacaaagatttcgtccct
tacttccgctctgcgaccccggagcaggagctgggcaaactgccgctgggttcgcgtccg
gcaaaacgtcgtccaaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgctggcgctgcgctgcagaag
gtggtcgaaggtggaaaacagagtgaactggaagccatgtgtcgcgactggccgttcttc
tctacccgcctcggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tactacgatcagcgcctggtgaagccggagctgtgggcgctgggttccgagctgcgcaag
ctgctggctgccgatatcaacgtcgtgctggccatcgccaacgactcccatctgatggcc
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggctgaagaagagggcaaggacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgtcgccgccggtatgcgt
aacaccggttaa

DBGET integrated database retrieval system