KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_03550Help
Entry
KPNIH29_03550     CDS       T03465                                 

Definition
(GenBank) galactonate oxidoreductase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00053  Ascorbate and aldarate metabolism
kpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    KPNIH29_03550
Enzymes [BR:kpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     KPNIH29_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C 3HCDH_N AdoHcyase_NAD HI0933_like Pyr_redox_2 FAD_binding_3 Pyr_redox_3 Sacchrp_dh_NADP DapB_N XdhC_C Pyr_redox TrkA_N FAD_binding_2 NAD_binding_8 adh_short NAD_binding_7 Egg_lysin Thi4 Shikimate_DH FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIX67680
UniProt: A0A422XW43
LinkDB All DBs
Position
736386..737408
Genome map
AA seq 340 aa AA seqDB search
MTSMNTLVCQEPKKLHWEKRQIPIPGDDEVLIKIKAVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIIGLGKNILNLKSGQQVAVIPYVACRHCPACLSGQTNCCENISVIGVHRDGGF
SEYLCVPVNNLLVVDDVDPEAVALIEPFAISAHAVRRAAIQPGDQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARRDHVAQHLGLTTLDPSDPLFTEQLSATFDGSLAQKVIDATGN
QQAMNNTVNLIRHGGSIIFVGLFKGELQFSDPEFHKKETTMMGSRNATEEDFAKVGRLMT
EGKVTARMMLTHRYDFKSLAEIYESDVINNRQLIKGVIHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatgaatactttagtatgtcaggaacctaaaaaattacactgggaaaaacgc
cagattcccattcccggcgatgatgaagtgctcattaaaataaaggcggtggggatttgc
gggacagatattcatgcatggggcggcaatcagcctttttttagctatccgcgtgttctt
ggtcatgaaatatgcggtgagataattgggctgggtaaaaatattcttaatttgaagagt
ggccaacaggttgctgtgattccctatgtcgcctgccgccactgcccggcctgtctgagc
ggccagacaaactgctgtgagaacatttcggtgatcggggtgcatcgcgacggcgggttt
agcgaatacctctgcgttccggtaaacaatctgctggttgtggatgatgtcgaccctgaa
gctgtagcgttgattgagccattcgccattagcgcccacgcggtgcgtcgcgcagcgatc
cagccgggagatcaggtactggtggtcggcgcgggtccgattgggctcggggcagcggcg
atcgctaaggctgacggcgcacaggtggtggtggcggataccagcccggcgcggcgcgat
catgtggcacaacatctcggcctgaccaccctcgatccctccgatccactgtttaccgag
caactgtcggccacgtttgacggttctctggcgcagaaagtgattgacgcgacgggaaat
cagcaagcaatgaacaacaccgttaatttaatccgtcacggcggcagcatcatttttgtt
ggtctgtttaagggggaactgcagttctctgacccggaatttcataagaaagagacgacg
atgatggggagtcgtaatgcgacagaagaggattttgccaaggtcgggcggctgatgact
gaagggaaagtgaccgccaggatgatgctgacccaccgttacgacttcaaatcgctggcg
gaaatttacgaaagcgacgtgattaacaatcgtcagctgatcaaaggcgttattcatttt
tag

DBGET integrated database retrieval system