KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_10030Help
Entry
KPNIH29_10030     CDS       T03465                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00030  Pentose phosphate pathway
kpv01100  Metabolic pathways
kpv01110  Biosynthesis of secondary metabolites
kpv01120  Microbial metabolism in diverse environments
kpv01130  Biosynthesis of antibiotics
kpv01200  Carbon metabolism
kpv01230  Biosynthesis of amino acids
Module
kpv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpv_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPNIH29_10030
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    KPNIH29_10030
Enzymes [BR:kpv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     KPNIH29_10030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AIX68870
LinkDB All DBs
Position
2062136..2064142
Genome map
AA seq 668 aa AA seqDB search
MKTTNTTRRQCANALRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPNNPAWAD
RDRFVLSNGHGSMLIYSLLHLTGYDLPIEELKNFRQLHSKTPGHPEVGYTAGVETTTGPL
GQGIANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLG
KLVAFYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKRAVEEARAVTD
KPSLLMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREALGWKHAPFDIPSDIYAQWDA
KEAGQAKEAAWNEKFAAYAKAFPQEAAEFTRRMKGEMPSDFDAKANEFIAKLQANPAKIA
SRKASQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKPINEDAAGNYIHYGVREFGMTA
IANGIALHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPV
EQVASLRVTPNMSTWRPCDQVESAIAWKYGVERQDGPTALILSRQNLAQQERTAEQLANV
ARGGYVLKECTGSQPELIFIATGSEVELAVAAWDKLTAEGVKARVVSMPSTDAFDKQDAA
YRESVLPKAVTARVAVEAGIADYWFKYVGLNGAIVGMTTFGESAPTEQLFEEYGFTVDNV
VAKAKALL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacaaataccactcgccgccaatgcgccaacgcgctgcgcgccctgagcatg
gacgcggtacagaaagccaaatccggccacccgggggccccgatgggtatggctgacatt
gccgaagtgctgtggcgtgatttcctgaaccataacccgaacaatccggcctgggctgac
cgtgaccgttttgtgttgtcaaatggccatggttcgatgctgatttacagcctgctgcac
ctcactggctacgatctgccgattgaagagctgaaaaacttccgccagctgcactccaaa
accccgggtcacccggaagtcggctacaccgcaggcgtggaaaccaccaccggtccgctg
ggccagggtatcgctaacgcggtcgggatggctatcgccgagaaaaccctggcggcgcag
ttcaaccgtccgggacacgatatcgtcgaccactacacctacgccttcatgggcgacggc
tgtatgatggaaggcatttctcacgaagtgtgctccctggccggtaccctgaaactgggt
aaactggtggcgttctatgatgacaacggcatctccatcgacggccacgttgaaggctgg
ttcaccgacgacaccgcgaaacgctttgaagcctacggctggcacgtggtgcgcggcgtg
gacggtcacgacgctgacgccatcaaacgcgcggtagaagaagcacgggcggtcaccgac
aaaccgtccctgctgatgtgcaaaaccatcatcggtttcggttcgccgaacaaagccggt
acccacgactcccacggcgcgccgctgggcgacgccgaaatcgccctgacccgcgaagcg
ctgggctggaaacacgcgccgtttgacatcccgtctgacatctatgcccagtgggatgcc
aaagaagccggccaggcgaaagaagcggcgtggaatgagaagttcgctgcctacgccaaa
gccttcccgcaggaagcagccgaattcacccgccgtatgaaaggcgagatgccgtctgac
ttcgacgcgaaagctaacgagttcatcgcgaagctgcaggccaacccggcgaaaatcgcc
agccgtaaagcctcgcagaacgccatcgaagccttcggcccgctgctgccggaattcctc
ggcggctccgcagatctcgcgccgtccaacctgaccctgtggtccggctctaagccgatc
aacgaagacgctgccgggaactacatccactacggcgtgcgcgagttcggtatgaccgct
atcgccaacggtatcgcgctgcacggcggcttcctgccgtacacctccaccttcctgatg
ttcgtggaatacgcgcgtaacgcggtacgtatggccgcgctgatgaaacagcgtcaggtg
atggtctacacccacgactcgatcggtctgggcgaagacggcccgactcaccagccggta
gagcaggtggcttccctgcgcgtgaccccgaacatgtccacctggcgtccgtgtgaccag
gttgaatccgcgattgcgtggaaatatggcgtggagcgtcaggacggcccgaccgcgctg
atcctctcccgtcagaacctggcgcagcaggagcgtaccgcagagcagctggcgaacgtg
gcccgcggcggttatgtgctgaaagagtgcaccggctcgcagccggagctgatcttcatc
gccaccggttcagaagtggaactggcggttgccgcatgggacaaactgactgccgaaggc
gtgaaggcgcgcgtggtttccatgccgtccaccgacgcgttcgacaagcaggacgcggct
tatcgcgaatccgtactgccgaaagccgtgaccgcgcgcgttgccgtggaagcgggtatc
gctgactactggttcaaatacgttggcctgaacggcgccattgttggcatgaccaccttc
ggtgagtctgcgccgactgagcagctgttcgaggagtacggcttcaccgtcgataacgtg
gttgctaaagcgaaagcactgctgtaa

DBGET integrated database retrieval system