KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_12035
Entry
KPNIH29_12035     CDS       T03465                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH29_12035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpv01001]
    KPNIH29_12035
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpv02022]
    KPNIH29_12035
Enzymes [BR:kpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     KPNIH29_12035
Protein kinases [BR:kpv01001]
 Histidine kinases
  OmpR family
   KPNIH29_12035
Two-component system [BR:kpv02022]
 OmpR family
  RstB-RstA
   KPNIH29_12035
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 R3H
Other DBs
NCBI-ProteinID: AIX69242
UniProt: A0A377ZS46
LinkDB
Position
complement(2449178..2450479)
AA seq 433 aa
MKKLFVQFYLLLFVCFLVMTMLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
DWSKTLKELDLNLSFDLHIEPISKFKLSESSMQHLRAGDIVALDDQYTFIQRIPRSHYVL
SVGPVPYLYFLHEMRLLDVALMAFIAISLAFPVFIWMRPHWQDMLRIETAAQRFGEGHLS
ERIHFDSMSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TEAESQALNRDIGQLEALIEELLTYARLDRPQTELSLTTPDFPAWISDHVEDIQMVNPQR
EVTLATLTHGNYGALDMRLMERVLDNLVNNALRYSSQRVAVSLTLQGSRASLLVEDDGPG
IAPEERERVFEPFVRLDPSRDRATGGCGLGLAIVHSIAQAMGGEVRCEASPLGGARFCFS
WPVYHQLPDFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaagctgttcgtgcagttctatcttctgctcttcgtctgctttctggtgatgacc
atgctggtcggtctggtctataaatttaccgcggagcgcgccggacggcagtcgcttgac
gatttgatgaaaagctcgctgtatctgatgcgcagcgagctgcgggagataccgccgcgc
gactggagcaagacccttaaagagctggacctgaatttatcgtttgatctgcacatcgag
ccgatcagcaaatttaagctgtcggaaagctcgatgcagcacctgcgcgccggcgatatc
gtcgccctcgacgatcagtacacctttattcagcgcattccccgcagccactatgtgctg
tcggtgggtccggtgccctatctctattttctgcatgagatgcgcctgctggacgtggcg
ctgatggcgtttattgctatctcgctggcctttccggtgtttatctggatgcgcccgcac
tggcaggacatgctgcgcattgagacggccgcccagcgctttggcgaaggtcacctcagc
gagcgcattcacttcgacagtatgtccagcttcgagcggctcggggtggcctttaaccaa
atggccgataacattaatgcgcttattgccagcaaaaagcagctgattgacggcatcgcc
catgaactcaggacaccgctggtacgcctgcgctaccgtctggagatgagcgagaatctc
accgaggcggaatcgcaggcgctgaaccgcgatatcggtcagctggaggcgctgattgaa
gagctcctgacctacgcccgcctcgaccgcccgcagacggagctcagcctgacgactccc
gattttcccgcctggatcagcgatcacgtcgaggatatccagatggttaacccacagcgc
gaggtcaccctggcgacgctgacccacggtaactacggcgcgctggatatgcgactgatg
gagcgggtgctggataatttggtcaataacgccctgcgctacagcagccagcgggtggcg
gtcagcctgacgctgcagggttcgcgcgcatcgttgctggttgaggatgacggcccggga
atcgcccccgaggagcgcgagcgggtgtttgagccctttgtccgccttgaccccagccgg
gaccgggcgacaggaggctgcggcctcggcctggcgattgtccacagtatcgcccaggcg
atgggcggcgaggtgcgctgcgaggccagccctctcggcggcgcccgcttctgctttagc
tggccggtctatcatcagctgcctgatttcacctctgcctga

DBGET integrated database retrieval system