KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_18155Help
Entry
KPNIH29_18155     CDS       T03465                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00010  Glycolysis / Gluconeogenesis
kpv00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH29_18155
   00500 Starch and sucrose metabolism
    KPNIH29_18155
Enzymes [BR:kpv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPNIH29_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIX70345
LinkDB All DBs
Position
complement(3648345..3649739)
Genome map
AA seq 464 aa AA seqDB search
MKTFPTDFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDNGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccgacggattttttatggggcggcgcgaccgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtacagccgcacggggtg
ttcggcgaagtggtcgagcgtgtacccggcgacaacgggattaaggatgtggcgatcgat
ttttaccatcgctatccggaagatatcgccctgtttgccgagatgggttttaactgcctg
cgagtctctatcgcctggacccgcatctaccccaacggcgacgacgccgagccgaacgaa
gccggcctcgcgttctacgacaagctgttcgacgagatggcgaagcacaacatcaccccg
ctggtgacgctatcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctacatgccccg
atgaccggggtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgtttgagacgctgcaggagaaccgcagctggcagttcttcggcgacgtacaggcgcgc
ggcgcgtacccgggttatatgcagcgctatttccgtgacaacggcatcacgctcaccatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgcacgctgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaatggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system