KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00365Help
Entry
KPNIH30_00365     CDS       T03466                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Brite
Enzymes [BR:kpw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPNIH30_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-ProteinID: AIX76760
UniProt: A0A1Y0Q4J2
LinkDB All DBs
Position
75471..76091
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVENFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccttacgcttacgatgctctggaaccgcacttcgac
aagcagacgatggagatccatcacactaaacaccaccagacctacgtgaacaatgccaac
gccgcgctggaaagcctgccggagttcgctaacctgtccgctgaagagctgattaccaag
ctggatcagctgccggctgacaaaaaaaccgtactgcgtaacaacgccggcggccacgcg
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggttccgtggagaacttcaaagcggaattcgaaaaagcc
gctgctacccgtttcggctccggctgggcgtggctggtcctgaaaggtgataaactggcc
gttgtctccaccgccaaccaggattccccgctgatgggcgaagccatttccggcgcttcc
ggcttcccgattatcggcctggacgtctgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagccttctgggacgtagtgaactgggacgaagctgcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system