KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_04325Help
Entry
KPNIH30_04325     CDS       T03466                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00473  D-Alanine metabolism
kpw00550  Peptidoglycan biosynthesis
kpw01100  Metabolic pathways
kpw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KPNIH30_04325 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPNIH30_04325 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KPNIH30_04325 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpw01011]
    KPNIH30_04325 (ddl)
Enzymes [BR:kpw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KPNIH30_04325 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:kpw01011]
 Precursor biosynthesis
  Amino acid ligase
   KPNIH30_04325 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AIX77485
UniProt: A0A2D1HQE1
LinkDB All DBs
Position
866103..867023
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLFGGTSAEREVSLNSGAAVLAGLREGGVDAHPVDPRDVDITQLKKQGFKKAFI
ALHGRGGEDGTLQGLLELIQLPYTGSGVMASAISMDKLRSKWLWQGAGLPVAPWVALTRA
QFAAGLSTDVEQQIAALGLPVIIKPSREGSSVGMSKVSESCDLASALALAFQHDDEVLVE
KWLSGPEFTVAIVGEEILPSIRIQAAGTFYDYEAKYLSDETQYFCPGFEDPARESAIQNL
VLKAWNVLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILDLAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtgcttttcggtggaacctccgctgaacgtgaagtgtcgctg
aattcaggcgcggcggtgctggccgggctgcgtgaaggcggggtggacgcccatccggtc
gacccgcgcgatgttgatattacccagctaaaaaagcagggctttaagaaagcgtttatt
gccctccacggccgcggcggggaagatggcactctgcaggggctgctggagttaatccag
ctgccttataccggcagcggcgtgatggcttcggcgatttcaatggataaactgcgcagc
aagtggctgtggcagggcgccggattaccggtcgcgccgtgggtggcgctgacccgcgcc
cagtttgccgccgggctgtctactgacgtcgaacagcaaattgcggcgctgggtctgccg
gtcatcatcaagccgagccgtgaaggctccagcgtcgggatgtcgaaagtcagcgaaagt
tgtgatttagcgagtgcattggcgttggcttttcagcatgatgatgaagttttggtcgaa
aaatggctcagtggaccggaatttaccgtcgccatagtcggtgaagaaattttaccgtca
atacgtatccaggccgcgggaaccttctatgattatgaggcgaagtatctctctgatgag
acgcaatatttctgcccaggatttgaagatcccgcgcgtgagtcagctattcagaacctg
gtgcttaaagcctggaatgttctgggttgcaaaggctggggccgtattgacgtgatgctg
gacagcgatggccagttttatctgctggaagcgaatacttccccgggcatgaccagccat
agccttgtgccaatggcggcgcgtcaggcaggaatgagcttctcccagcttgttgtacga
attctggacctggcggggtga

DBGET integrated database retrieval system