KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_05505Help
Entry
KPNIH30_05505     CDS       T03466                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00730  Thiamine metabolism
kpw00790  Folate biosynthesis
kpw01100  Metabolic pathways
kpw02020  Two-component system
Module
kpw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KPNIH30_05505
   00790 Folate biosynthesis
    KPNIH30_05505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH30_05505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpw04147]
    KPNIH30_05505
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpw00537]
    KPNIH30_05505
Enzymes [BR:kpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KPNIH30_05505
Exosome [BR:kpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH30_05505
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpw00537]
 Enzymes
  KPNIH30_05505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AIX77698
LinkDB All DBs
Position
1105087..1106517
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggc
tcgccggttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcag
ggagatatcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaa
ggaattgatgctctgccgttaaccgggcagtacacgcattattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacttataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtc
accagcgaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggc
taccagattgtgaccgacgcggcttctcttgccgccgcgacggaagccagtcaggataaa
ccgctgctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcg
tcttatcacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgac
gcctcggtgccgacgctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaac
gagaaaggtttcttcctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggcc
aatccgtgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctg
gaattcgcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgcc
agccagatcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcac
gatggcgcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacacc
ggcacccaactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system