KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_08775Help
Entry
KPNIH30_08775     CDS       T03466                                 

Definition
(GenBank) peptidase M15
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00550  Peptidoglycan biosynthesis
kpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPNIH30_08775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kpw01002]
    KPNIH30_08775
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpw01011]
    KPNIH30_08775
Enzymes [BR:kpw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KPNIH30_08775
Peptidases and inhibitors [BR:kpw01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KPNIH30_08775
Peptidoglycan biosynthesis and degradation proteins [BR:kpw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KPNIH30_08775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIX78315
UniProt: A0A3N0M720
LinkDB All DBs
Position
1750363..1751565
Genome map
AA seq 400 aa AA seqDB search
MMHDAFSLRGLAAGCALLFLVAPAVQAAEQLPDAPSIDARAWILMDYASGKVLSEGNADE
KLDPASLTKIMTSYVVGQAIKAGKIKLTDMVTVGRDAWATGNPALRGSSVMFLKPGMQVS
VEDLNKGVIIQSGNDASIAIADYVAGSQDAFVSLMNGYAKKMGLTNTTFMTVHGLDAPGQ
FSTARDMALLTKALIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSSNLNADGVKTGTTA
GAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDSNEAKLGAGEAGSITLPKGQLKNLKASYTLNQPQLTAPLEKGQVVGTIDFKLND
KTIEQRPLIVMESVKEGGFFSRMIDFVLMKLHGWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgacgctttttcccttcgcggcctcgcggcaggttgcgcgctgttatttctt
gtcgcacctgcggtgcaggctgcggaacaactccccgacgccccttcaattgacgctcgc
gcctggatcctgatggactatgccagcgggaaggtgctcagcgaaggcaatgccgatgaa
aaactcgacccggccagtctgacgaagatcatgaccagctacgtggtagggcaggcaata
aaagcgggaaaaatcaaactgaccgatatggtgaccgttgggcgcgatgcctgggcgacc
ggcaacccggcgctgcgcggctcatcggtgatgttcctcaagcctggcatgcaggtttcc
gtagaagatctgaacaaaggggtcatcattcagtccggtaacgacgccagcattgcgatt
gctgactacgtagcgggcagccaggacgctttcgttagcctgatgaacggctacgccaaa
aagatggggctgaccaacaccacctttatgaccgtccacggccttgacgcgccggggcag
ttcagcaccgcccgcgatatggcgctgctgaccaaagcgctgatccacgacgtaccggaa
gagtacgcggtacataaagagaaagagttcactttcaataaaattcgccagccgaaccgc
aaccgcctgctgtggagcagcaacctcaacgccgatggcgtgaaaaccgggaccaccgcc
ggggccggctataacctcgtctcctcggccactcagggtgatatgcgtttgatcgccgtg
gtgctggggaccaaaaccgaccgcattcgctttaacgagtcagaaaaactgctgacctgg
ggcttccgcttctttgaaaccgtgacgccgattaaaccagatgccaccttcgttacccag
cgcgtgtggtttggcgatagcaatgaagcgaaactgggggctggcgaggcgggctctatc
actttgccgaagggccagctgaaaaacctgaaagccagctataccttaaatcagccgcag
cttaccgcgccgctggagaaggggcaggtggtcgggactatcgactttaagctaaatgat
aaaaccattgaacagcgtccgctgattgtcatggagtcggtaaaagagggcggcttcttc
agccggatgatcgacttcgtgctgatgaaactgcacggctggttcggcagctggttctcc
tga

DBGET integrated database retrieval system