KEGG   Klebsiella pneumoniae PMK1: PMK1_00145Help
Entry
PMK1_00145        CDS       T03419                                 

Gene name
glpA
Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00564  Glycerophospholipid metabolism
kpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PMK1_00145 (glpA)
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PMK1_00145 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_oxidored FAD_binding_2 DAO_C FAD_binding_3 NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like 3HCDH_N Pyr_redox GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIS99659
UniProt: W9BAV9
LinkDB All DBs
Position
179537..181159
Genome map
AA seq 540 aa AA seqDB search
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPTNGLFITLPEDDLAWQQTFIDACQQAGIEATPLS
PQEALRREPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRRGD
RVCGVQVYDRQLHQARTLYAGMVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAAEVDTLLREGEKLAPVM
GRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCTTAEAPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTPSW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLTQLSEFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHRDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacgtcttgatagcgaggtcattatcatcggcggcggagcaaccggcgccggt
atcgcccgcgactgcgcccggcgcggattacgaacgctgctcattgagcgccatgatatc
gccaccggggcgaccggccggaatcatggactgctgcacagcggcgcccgctacgcggtg
accgacaacgaatccgcccgcgaatgcatcagtgagaaccgcatcctgcgccgcatcgcc
cgccactgtattgaaccgaccaatgggctgtttatcaccctgcctgaagatgacctggca
tggcagcaaacctttatcgacgcctgtcagcaggctggcatagaggccacgccgctctcg
ccgcaggaagcgctgcgccgggagcccgccgtcaacccgacgctgctgggcgcggtgcag
gtcccggacggtaccatcgacccgtttcgcctcaccgcggccaatatgctcgacgcccgc
gaacacggcgcgcagatccttaccggctgcgaagtaacaggcctgctgcgccggggcgat
cgcgtctgcggcgtccaggtatacgaccgccaacttcaccaggcccgtactctgtacgcc
gggatggtggttaacgccgccgggatctgggggcagcgtattgcggaatatgccgacctg
cgcatcaccatgttcccggcgaagggatcgctgctgatcctcgatcatcggattaacaac
ctggtgatcaaccgctgccgtaagccggccgacgccgatattctggtgcccggcgatacc
atctcgctgatcggcactacctcaatgcatattccttatgacgaaattgacgacaaccgg
gtaacagcggcggaggtcgataccctgctgcgcgaaggggaaaagctggcgccggtcatg
ggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagcgataac
gatcccagcgggcgcagcgtcagccgcggcatcgtcctgctcgaccatgcccagcgtgac
ggtatggaaggcttcattaccattaccggcggcaagctgatgacctatcgcctgatggcc
gagtgggccaccgacgccgtctgtcgtaagctgggaaacaccaccccctgtaccacggcc
gaagccccgctgcccggttcacaggagccaacggaaagtaccctgcaaaagataatctcc
ctccccaccccgctgcgcggctcggccgtctaccgtcacggcgatcgcaccccgtcctgg
cttggcgacagccgccagcaccgtagcctggtctgcgaatgtgaagccgtcactgccggt
gaagtgaaatacgcggtggaaaacctggcggtcaacaccctgctcgacctgcgccgccgc
acccggattggcatgggtacctgtcagggggaactctgcgcctgccgcgctgccggcctg
ctgcagcgctttaacgtcaccacgcccgcgcagtcgttaacccagctctcggaatttctc
aatgaacgctggaagggcgtgcagcccatcgcctggggcgatgcgctgcgcgaaagcgaa
ttcacccgctgggtctacctcggcctgtgcggattgccacaggagcaccgggatgaagtt
tga

DBGET integrated database retrieval system