KEGG   Klebsiella pneumoniae PMK1: PMK1_00834Help
Entry
PMK1_00834        CDS       T03419                                 

Gene name
rpiA
Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
kpx00030  Pentose phosphate pathway
kpx01100  Metabolic pathways
kpx01110  Biosynthesis of secondary metabolites
kpx01120  Microbial metabolism in diverse environments
kpx01130  Biosynthesis of antibiotics
kpx01200  Carbon metabolism
kpx01230  Biosynthesis of amino acids
Module
kpx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpx_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMK1_00834 (rpiA)
Enzymes [BR:kpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PMK1_00834 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AIT00331
UniProt: W9B3P5
LinkDB All DBs
Position
complement(907024..907683)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcggtaggttgggcagcactgcaatatgtacagcca
gggactattgtcggcgtaggcaccggctcgacggcggcccattttattgacgcgctgggc
accatgaaggggcagatcgaaggggcggtttccagctccgacgcctccaccgagaagctg
aaaagcctcgggatcaccgtcttcgatcttaacagcgtcgatcgcctggggatctatgtt
gacggcgcggatgagatcaacggccatatgcagatgatcaaaggcggcggcgcggcgctg
acccgtgaaaagatcatcgcctcggtcgcggataagtttatctgcatcgccgacgcctcc
aagcaggtcgatattctgggcaagttcccgctgccggtggaagtcattccgatggcgcgc
agcgccgtggcgcgtcagctggtcaagctgggcggccgtccagagtaccgtcagggcgtg
gtgaccgataacggcaacgtgatccttgacgtgcacggcctggaaattctcgatgcgatc
gcgctggaaaacgcgatcaacggtattcctggcgtcgtcaccgtggggctgttcgccaac
cgtggcgccgacgtggcgctgattggtactgccgacggcgtgaagaccatcgtaaaatag

DBGET integrated database retrieval system