KEGG   Klebsiella pneumoniae PMK1: PMK1_01360Help
Entry
PMK1_01360        CDS       T03419                                 

Gene name
pitA
Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
kpx  Klebsiella pneumoniae PMK1
Brite
KEGG Orthology (KO) [BR:kpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpx02000]
    PMK1_01360 (pitA)
Transporters [BR:kpx02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PMK1_01360 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AIT00852
UniProt: W9BAS7
LinkDB All DBs
Position
1439988..1441484
Genome map
AA seq 498 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVAMAALF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSAHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVIGIFASLIISPIVGLVIAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVSFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNASGYEITRTRDAVNNVETFFQQRPELLKKATGVDQLVPSPDTNTAA
NGEFHCHPANTINALDRVKTMLTGVENYESLKPEQRGQLRRIMLCISDTTDKVAKLPDVS
ADDQRLLKKLKTDMLSTIEYAPIWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTYA
QGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMLVDGGGLQKKTVTSILMAWVLTL
PAAIILSGVLYWLSLKLI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttatttgccggtctggatttacataccggactattattattgcttgcttta
gcttttgtactgttttacgaagcaattaacggtttccatgataccgcaaacgcggtggct
acggttatctacactcgcgcaatgcgctcacagctcgctgtggcgatggcggcgctcttc
aacttcttcggcgttctgctgggcggtctcagcgtagcctatgccatcgtgcatatgctg
ccgaccgatctgctgcttaacatgggttccgcacatggcctcgccatggtgttctctatg
cttctggcggcgatcatctggaacctcggcacctggtacttcggtcttccagcttccagt
tctcataccctgattggcgccatcatcggcattggtttaaccaatgcgctgatgaccggt
acttccgtggttgatgcgctgaatatcccgaaagtcatcggcatttttgcttcgcttatc
atctcgccgatcgtcggtctggtgatcgcgggcggcctgattttcctgctgcgtcgctac
tggagcggaaccaaaaaacgcgcgcgtatccacctgacgcccgcagagcgtgaaaagaaa
gacggtaagaaaaagccgccgttctggacccgtatcgcgctgatcctgtctgctattggc
gtgtcgttctctcacggtgctaacgatgggcagaaaggcattggcctggtgatgctggtg
ctgatcggcgtcgcgccggcgggtttcgtggtgaatatgaatgcctctggttacgaaatc
acccgtacccgcgatgcggtcaacaacgtggaaaccttcttccagcagcgtcctgaactg
ctgaaaaaagccaccggcgtcgatcagctggtgccttctccggataccaataccgcggcc
aatggcgagttccactgccatccggcgaacaccatcaacgcccttgaccgcgtcaaaacc
atgctgaccggcgttgagaactacgagtcgctaaaaccggaacagcgcggccagctgcgt
cgcatcatgctctgcatctccgacaccaccgacaaggtggcgaagctgccggatgtgagc
gctgacgaccagcgtctgctgaagaaactgaaaaccgatatgctgagcaccatcgagtac
gcgccaatctggattatcatggctgtcgcgctggcgctgggtatcggcaccatgatcggc
tggcgccgcgtggcgaccaccatcggtgagaagattggtaagaaaggcatgacctacgct
caggggatgtcggctcagatgaccgcagcggtttctatcggtctggcgagctacaccggg
atgccggtttccaccacccacgtactctcctcctcggtagcggggacgatgctggtggat
ggcggtggtctgcagaaaaagacggtgaccagcattctgatggcctgggtgctgaccctg
ccggcagcgattatcctttcaggcgtcctttactggctctccctgaaactgatttaa

DBGET integrated database retrieval system